KEGG   Candida glabrata: CAGL0K09328gHelp
Entry
CAGL0K09328g      CDS       T01024                                 

Definition
(RefSeq) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cgr  Candida glabrata
Pathway
cgr00260  Glycine, serine and threonine metabolism
cgr00750  Vitamin B6 metabolism
cgr01100  Metabolic pathways
cgr01110  Biosynthesis of secondary metabolites
cgr01230  Biosynthesis of amino acids
Module
cgr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CAGL0K09328g
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CAGL0K09328g
Enzymes [BR:cgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CAGL0K09328g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 2890257
NCBI-ProteinID: XP_448625
UniProt: Q6FMB9
Position
K:complement(920567..922105)
Genome map
AA seq 512 aa AA seqDB search
MSSSQVYRSTRSAEQESKSFEEAVIQGLATDGGLFVPSTIPTVSKDTLFSKWSKLSFQEL
AFEIMRLYIDSKEIPDADLKSLIERSYSTFRSDDVTPLVKNVTGNEENLHVLELFHGPTY
AFKDVALQFVGNLFEYFLQRINKDLPEEQRKRLTVVGATSGDTGSAAIYGLRGKKDVSVF
ILYPTGRISPIQEEQMTTVEDKNVQTLSVAGTFDNCQDIVKAIFGDKDFNSRHNVGAVNS
INWARILAQMTYYFYSYFRATDGKEGKVKFVVPSGNFGDILAGYFAKQMGLPVEKLVIAT
NENDILDRFLKTGTYERSANVLATHSPAMDILISSNFERLLWYLAREFLAEKDDLKAGEI
INTWFTQLKTEGKFVVDKSIIEGALQDFASERVSNEETIQTIKKMYEISQNPKKYVLDPH
TAVGVCATERLIKKDNDKEIQYVSLSTAHPAKFAEAVNQALSSFDGYSFESDVLPAELKR
LSTLPKKIKLVEKADVTLVKNTIEEELAKMGL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcctctcaagtgtatagatccactagatccgctgagcaagagtctaagtccttc
gaggaagctgttattcaaggtctggctactgatggtggtcttttcgttccatctaccatc
ccaacagtctccaaggacacacttttcagcaagtggtctaagttgtctttccaagagttg
gcttttgaaattatgagactatacattgactctaaggaaattccagatgctgacttgaag
tccttgattgaaagatcctactccactttccgctccgatgacgttaccccattggtaaag
aacgttaccggcaatgaagagaacttgcatgttcttgaattattccatggtccaacatat
gctttcaaagatgtcgctttgcaatttgtcggtaacttgtttgaatacttcctgcaaaga
attaacaaggacttacctgaagaacaaagaaaaagattaactgtcgttggtgctacttct
ggtgacacaggttctgcagcaatctacggtctaagaggtaaaaaggatgtttctgtcttc
atcctttacccaactggtagaatttctccaatccaagaagaacaaatgactactgttgag
gacaagaacgtccaaactttgtccgtcgctggtacatttgataactgtcaagatatagtt
aaagccatctttggtgacaaggatttcaactccagacacaatgttggtgctgttaactcc
atcaactgggctagaattttggctcaaatgacctattacttctactcttacttcagagcc
acagatggcaaggaaggtaaggttaagtttgttgtgccaagtggtaatttcggtgatata
ttagctggttactttgctaagcaaatgggtttacctgttgaaaagctagttattgccact
aatgaaaatgatattcttgacagatttttgaagaccggtacttacgaaagatctgccaat
gttttggctacacactctccagctatggacatcttgatttcttccaactttgaaagatta
ctgtggtaccttgctcgtgaatttttggctgaaaaggatgacttgaaggctggggagatc
atcaacacttggtttacccaattgaagacagaaggtaaatttgttgttgataaatctatc
atcgagggtgctctacaggattttgcatctgaaagagtctctaatgaggaaactattcaa
actatcaagaaaatgtatgaaatttcccaaaatccaaagaagtatgtcttggatcctcat
acagccgttggtgtttgtgccaccgaaagattgatcaagaaagataacgataaggagatt
caatatgtttccctgtcaacagcccacccagccaagtttgccgaagctgttaaccaagct
ttgtcctcctttgatggctactcattcgaatctgacgttctgccagctgaattgaagaga
ttgtctactctaccaaagaagataaagttggttgaaaaggccgatgtcactttggtaaag
aacactattgaagaagaacttgccaagatgggtttgtaa

DBGET integrated database retrieval system