KEGG   Candida glabrata: CAGL0K09966gHelp
Entry
CAGL0K09966g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
cgr  Candida glabrata
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CAGL0K09966g
Translation factors [BR:cgr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CAGL0K09966g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:complement(974931..977090)
Genome map
AA seq 719 aa AA seqDB search
MAAAEIKLEDIPVDDIDFTDLEKEYSVDDEFKFDNYVVVTGAPVIPESKVPVLKKALGGL
FSKAGKVVDMEFPLDDDKKSKGFLFVECGSDVDAKKIIKAFHGKRLDLKHRLFLYSMRDV
EKLSEQGAGEFVEPELPGFVPTSTLKSWLADEDGRDQFVIQKDNLTGIFWNSMHESEDDV
VESRTNWSTNYVRFSPRGTYLFSYHPQGVTSWGGPQFDRLRRFYHPNVRTSSVSPDEHYL
VTFSPEPIELDDSVPESPFTKRNEGHHICVWEIDTGLLCASFPLTKNPNLQWPFVKFSYN
DKYCARFVGDRLAVYDCTNKFSLLEAPALKVSGIRDFSFAPTGVELQPFNKNDEPSVLLS
YWTPETNNSACTASVVQVPRGRVLKTVNLVQVSNVTTYWPEGGEYLVFNVERHTKSKKTL
FSNLQICKLTEKDIPVEKIEVKDRIMEVGWEPHGHRFITISTTEGPDDNIAIPKNVVRFY
APEKKEGVKNKIVVKRWVVIKEIEKKFYNTVSWSPAGRFVTVCALVKPNMRKSEFQFFDL
DYPGEKNLNERKDVLATLKDVGESNYGAATDLCWDPSGRFLTAWSSSLKHKMENGYKMFN
IAGVIIKEDILPNMKNFAWRPRPESLLSNAEKKKVRKTLKEWSAEFDEQDAMANDSAVRD
LILKQRAMLKEWREYRAAKAQTTTIFDIAPWLDTTKDHEDFVKIEEIKEEIVEEIKEKL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgctgagatcaagctggaagacattcctgttgatgacattgacttcactgat
ttggagaaggagtactctgttgatgatgagttcaagtttgacaattacgttgtagttact
ggtgcgccagttattccagagtccaaggtccctgttttgaagaaggctttgggtggtctt
ttctcgaaggccggtaaggttgtcgacatggagttcccattggatgacgacaagaagagc
aaaggtttcctgtttgtggagtgtggttcagatgttgatgccaagaagatcatcaaggct
ttccatggtaagcgtttggatttgaagcaccgtctgttcctttacagcatgcgcgatgtt
gagaagttgagcgagcaaggtgctggtgagtttgtcgaaccagagttgcctggttttgta
ccaacttctacattgaagtcctggttggctgacgaggacggaagagaccaattcgtcatc
cagaaggataacttgaccggtatcttctggaactctatgcatgaaagcgaggacgatgtt
gttgaatctcgtaccaactggtccaccaactacgttaggttctctccaagaggtacttac
ttattctcataccatcctcaaggtgttacctcatggggtggtcctcagtttgaccgtttg
agaagattctatcatccaaacgtcagaacttcctctgtttccccagatgaacattatcta
gttactttctccccagagccaattgaactggacgactctgtcccagaatctcctttcaca
aagcgtaacgaaggtcaccatatctgtgtgtgggaaatcgacaccggtctattgtgtgct
tctttcccattgaccaagaaccctaacttgcaatggccattcgttaagttctcttacaac
gacaaatactgtgctagatttgttggtgacagattggcagtttacgactgtactaacaag
ttctccttgctagaagccccagcactaaaggtctctggtatcagagacttctccttcgca
ccaactggtgttgagttgcaacctttcaacaagaacgacgaaccatctgttctgttatct
tactggactcctgaaacaaacaacagtgcttgtacagcctctgttgttcaagttcctaga
ggccgtgtcctaaagacagtcaaccttgtgcaagtttctaacgttaccacttactggccg
gaaggtggtgaataccttgttttcaacgttgagcgtcacactaaatccaagaagacttta
ttcagtaacttgcaaatctgtaaattgactgaaaaggacatacctgtcgagaagatcgag
gtcaaggacaggatcatggaagttggctgggaacctcatggacacagattcatcactatc
tctaccacagaaggtccagacgataacattgccattccaaagaacgtcgttaggttctac
gcaccagagaagaaagaaggtgttaagaacaagatcgtcgttaagagatgggttgtcatc
aaggaaatcgaaaagaagttctacaacaccgtttcctggtcgccagctggtagatttgtt
acagtctgtgccttggttaagccaaacatgcgtaagtctgaattccagttcttcgacttg
gattacccaggtgagaagaacttgaacgaacgtaaggatgttcttgccactctgaaggac
gttggtgaatccaactacggtgctgccactgatctatgttgggacccatctggtagattc
ttgaccgcttggtccagttccctaaaacacaagatggagaacggttacaagatgttcaat
atcgccggtgttatcatcaaggaagacattcttccaaacatgaagaattttgcttggaga
ccaagaccagaaagcttgttgtccaacgccgaaaagaagaaggtcagaaagacattgaag
gagtggtccgccgaattcgacgagcaagacgctatggccaacgacagtgccgtcagagac
ttgatcttgaagcaacgtgctatgttgaaggaatggcgtgaatacagagccgctaaggcc
caaacaaccaccatctttgacattgctccttggttagacaccactaaggaccatgaagac
ttcgtcaagattgaagaaattaaggaagaaatcgtagaagaaatcaaggaaaagttgtaa

DBGET integrated database retrieval system