KEGG   Candida glabrata: CAGL0K10494gHelp
Entry
CAGL0K10494g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
cgr  Candida glabrata
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
K:1023698..1025185
Genome map
AA seq 495 aa AA seqDB search
MSNDTFSFNIKHAGKVLPITLSNDATALDLKTQVEELTQVPRSRQKFMVKGGLSDDSIAN
LQTIIKPGSTVMLLGTPDANLLSKPAEKHRFVEDLSPDQQVQQFNSTPLGLQNMGNTCYL
NATLQALFRADELKDLILQYDPSKVTNSDANDEIHYKIVLELKRTFETLKKRSFKSVLPI
MLLNTLRKCYPQFAERDPQGGFYKQQDAEELFTQLFHTLTVVFGDKFANQFQINFRATIK
DTANEDDVTVREDESDMKLQCHISGTTNFMKNGLIESLNEKIEKRSDITGLNSTYAVQKQ
ITKLPKYLTVQYVRFFWKRSSGKKSKILRKVVFPFQLDVADLLTPEYANEKIKVREELRE
VEKAKNEKEREAKKRKVEQTDVVMTPKEEYETKKALEESEREYWLNEFKKRFPSNLAAGE
NPSSVYDLIGVITHQGANSESGHYQAFIRDESDENKWYKFNDDKVSPIEKEKIEALAGGG
ESDSALILLYKGFGL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgatacattctcctttaacatcaaacatgcaggcaaggttttgccaattacc
ttatcaaatgatgcaacagcacttgatctgaagactcaagttgaggaattgactcaggtc
ccaagatctagacaaaaatttatggttaagggaggcttgtccgatgattctatcgccaat
cttcaaacaataataaagcccggcagtactgtcatgctattagggacacctgatgctaat
ctactttcgaagcctgctgaaaaacatagatttgtagaggacttgtcaccagatcaacag
gttcagcaatttaactccacaccacttggcctgcaaaatatgggaaacacctgttacctg
aacgctacattacaagctttattcagggctgatgaactgaaagacttgatcttgcaatat
gatccatctaaagtaacaaactctgatgccaatgacgaaattcactacaagatagtattg
gaattaaagagaacttttgaaacattgaaaaagagaagttttaaatcagttttgccaatt
atgttactgaacacactaaggaaatgctatcctcagttcgcggaacgtgatccacaaggt
ggattttataagcaacaggacgccgaggaactattcacccaactattccatacgctgact
gttgtcttcggagataaatttgccaaccaattccaaatcaatttcagagcgacaataaag
gatacagccaatgaagatgatgttactgtgagagaggatgaaagtgatatgaaactacag
tgtcacatctcaggtactaccaacttcatgaaaaatggtttgattgaatctctaaatgaa
aaaattgaaaagagatcagatataactggattgaattccacttacgcagttcaaaaacaa
attacaaaacttcctaagtatttaactgtgcaatatgtcagatttttctggaaaaggtcc
tcaggaaagaagtcaaagattttaagaaaagttgttttcccattccaactagatgtagct
gacctgttaacaccagaatatgcgaacgagaagatcaaagtacgtgaagaactaagagaa
gttgaaaaggctaagaatgaaaaggagcgtgaagctaagaagcgtaaagttgaacaaact
gatgtagtaatgacgcctaaagaagaatatgagactaaaaaagctctggaggagagtgag
agagaatactggctcaacgaattcaagaagcgttttccatctaatttagctgctggggag
aatccctcctcagtatatgacctaataggtgtcattacccatcaaggtgccaactctgaa
tctggacactaccaagctttcatcagagacgaaagtgatgaaaacaaatggtacaagttc
aatgacgacaaagtcagtccaattgagaaagagaagattgaggcattggcaggaggcggt
gaaagtgacagcgctctaatccttctttacaaaggttttggtctataa

DBGET integrated database retrieval system