KEGG   Candida glabrata: CAGL0L00605gHelp
Entry
CAGL0L00605g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cgr  Candida glabrata
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:75253..75780
Genome map
AA seq 175 aa AA seqDB search
MGAAPSKIVETLLEDTNFDRDEIERLRKRFMKLDRDSSGSIDKNEFMSIPGVSANPLAGR
IMEVFDADNSGDVDFQEFITGLSIFSGRGSKDEKLKFAFKIYDIDKDGLISNGELFIVLK
IMVGSNLDDKQLQQIVDRTIMENDLDGDGQLSFEEFKSAIETTEVAKSLTLQYSV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgcaccatctaaaattgtagagactctattggaggacaccaattttgacaga
gatgagatagaaaggctacgtaaacggtttatgaaattagacagagatagttcagggtct
atagacaaaaatgagtttatgagtatacctggcgtgtctgcaaacccattagctggacgt
attatggaagtctttgacgctgacaatagtggtgatgttgattttcaagagtttattact
gggctttctatattcagtggaagaggttcaaaagacgagaagttaaagtttgcattcaaa
atatatgatatagacaaggatggtctgatatccaacggtgagcttttcattgtgttaaag
attatggtgggctcaaaccttgatgacaagcaattgcaacagattgttgaccgtactatc
atggagaatgatttagatggtgatggtcaactaagttttgaagaattcaagagtgctatt
gaaactaccgaagtagcaaagagcctgacccttcagtacagcgtgtag

DBGET integrated database retrieval system