KEGG   Candida glabrata: CAGL0L00649gHelp
Entry
CAGL0L00649g      CDS       T01024                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cgr  Candida glabrata
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAGL0L00649g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAGL0L00649g
   00620 Pyruvate metabolism
    CAGL0L00649g
   00640 Propanoate metabolism
    CAGL0L00649g
  Energy metabolism
   00680 Methane metabolism
    CAGL0L00649g
Enzymes [BR:cgr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CAGL0L00649g
Lipid biosynthesis proteins [BR:cgr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CAGL0L00649g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:complement(80936..83050)
Genome map
AA seq 704 aa AA seqDB search
MSPSAIAEKKQVDNIQEIKDKNQEPAHHEYEHLTNVGVVKQKPIDHRLKDNIKTHYSPHL
DGLQEYKRQYQESIENPEKFFSEKARSFMNWFRDFDRVFVPDVDNPTKPSFENNAWFLNG
QLNTCYNCVDRHALKTPNKTAIIYEADEPGEGYSMSYKELLEKVCQVAQILKYSMNVKKG
DTVAVYMPMIPEALITLLAISRIGAIHSVVFAGFSSNSLRDRINDAGSRVVITADESNRG
GKIIETKRIVDDALRETPQVEHVLVYRRTNNPQVNFQAPRDLDWETERKKYKTYFPCEPV
DSEHPLFLLYTSGSTGTPKGVQHSTAGYLLGALLTMRYTFDVHQEDVFFTAGDIGWITGH
TYCVYGPLLYGCTTLVFEGTPAYPNFSRYWEIIDKHQVTQFYVAPTALRLLKRAGDSFID
GFSLKSLRCLGSVGEPIAAEVWEWYSDKIGKNEIPIVDTYWQTESGSHLVTPLAGGVTPM
KPGSASLPFFGIETVILDPTTGEEINDSHAEGVLAIKRPWPSFARTIWKNHDRFLDTYLN
PYKGYYFTGDGAARDKDGYIWILGRVDDVVNVSGHRLSTAEIEAAIIEDRMVAECAVVGF
NDDLTGQAVAAFVVLKDKSTWASASEEELQDIKKHLILTVRKDIGPFAAPKLIVLVDDLP
KTRSGKIMRRILRKILAGESDQLGDVSTLSNPGVVKHLIDSVKL
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccatctgctattgctgagaagaaacaggtggacaacatccaggagatcaaggac
aagaaccaggagcctgcgcaccacgagtacgagcacttgaccaatgtcggtgtggtcaag
cagaagcctatcgaccacaggttgaaggacaacatcaagacccactactcgcctcacctg
gacggcttgcaggagtacaagagacagtaccaggagtccatcgagaacccagagaagttc
ttcagcgagaaggcacgctctttcatgaactggttcagggacttcgacagggtcttcgtg
ccagacgtggacaacccaacaaaaccttccttcgagaacaacgcctggttcctgaacggc
caattgaacacttgctacaactgtgtcgacagacacgctttgaagactccaaacaagacc
gccatcatctacgaggcagacgagcccggtgaaggctactcgatgtcttacaaggaactg
ctggagaaagtctgccaagtggcacagatcttgaagtactccatgaacgtcaagaaaggt
gacactgttgcagtctacatgccaatgatcccagaagcactcatcactttgctagccatc
tcgagaatcggtgccatccactccgtcgtcttcgcaggtttctcttcaaactccctaaga
gaccgtatcaatgacgccggctcccgcgtagtgatcaccgctgatgagtccaacagaggc
ggcaagatcatcgaaacaaagagaatcgtagatgacgccttgagagaaaccccacaagtc
gaacacgtcctggtctacaggcgtaccaacaaccctcaagtcaacttccaagctccaaga
gacttggactgggaaactgagagaaagaagtacaagacttacttcccttgcgaacccgtc
gactcagaacacccattattcttgctttacacctcgggatctacaggtactccaaagggt
gttcaacactctaccgcaggctacctactgggcgccctgttgacgatgagatacactttc
gacgtccatcaggaagacgtgttcttcaccgctggtgacatcggttggatcacaggccac
acatactgtgtatacggtcctttgctgtacggttgtactactttggtcttcgaaggtacc
cctgcttatccaaacttctctcgttactgggaaatcattgacaaacaccaagtcacccag
ttctacgttgcaccaactgctctgcgtctactaaagagagctggtgactcattcatcgac
ggcttctccctgaagtctctacgttgtttgggctcagttggtgaacctatcgctgctgaa
gtctgggaatggtactctgacaagatcggtaagaacgagattcctatcgtcgacacttac
tggcaaaccgagtctggttctcacttggtcactcctttggcaggtggtgtcacaccaatg
aaaccaggttctgcatcattgccattctttggtatcgaaaccgtcatcctggacccaact
actggtgaagagattaacgactctcatgcagaaggtgtcctggcaattaagagaccatgg
ccatcctttgccagaaccatttggaagaaccatgacagattcttggacacctacttgaac
ccatacaagggctactatttcacaggtgatggtgccgctagagacaaggatggctacatc
tggattttgggtcgtgttgacgatgtcgttaacgtctccggtcacagactatccacagct
gaaattgaagctgccattatcgaggacagaatggtcgccgagtgtgctgtcgttggtttc
aacgacgatctgaccggtcaagctgttgctgctttcgtggtcttgaaggacaaatcgacc
tgggcttctgcctccgaggaagaacttcaagatattaagaagcacttgattttgactgtg
agaaaagacattggtccctttgctgcaccaaaattgattgtcttggttgatgacttacca
aagaccagatccggtaagatcatgaggcgtatcttgagaaagattttggcaggtgagtct
gatcaattaggtgacgtctctaccttatccaatcctggcgttgttaagcatttgattgac
tctgttaaattgtga

DBGET integrated database retrieval system