KEGG   Candida glabrata: CAGL0L00693gHelp
Entry
CAGL0L00693g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
cgr  Candida glabrata
Brite
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CAGL0L00693g
    1.3.1.94  polyprenol reductase
     CAGL0L00693g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:87330..88079
Genome map
AA seq 249 aa AA seqDB search
MIDNSNILQLITICLRLSNIVGLMSLIIAKYYLPDFLRYGKTFTFAKNGNENIWDKIKNF
SVPKSYFAHFYILSSVLALVTLASYPTDILVWQLFLHSSRRLYETLYISKYTEKSKMNWS
HYAVGLWFYSQLNILVYLRVQRENTTARVLPILVMVLASWDQYKNHVVLSKLKKYSLPRS
RLFELVCCPHYLDEMIIYGSLVSYGHEFVWPLIWVIASLSISALESRKFYLSKFKDTEVP
RYAAIPYIL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgatagataactcaaatatattacaattgataaccatatgtctacggttaagtaatatt
gttgggctcatgtccttgattattgcaaagtactaccttcctgacttccttagatatgga
aagacatttacatttgcgaagaatggtaatgagaatatatgggataaaatcaagaatttt
agtgtacctaagtcatattttgcccatttttatattctctcatcagtgttagcattagta
acactggcatcatacccaacagatatcctagtatggcaactgtttttacattcttcaaga
agactctacgaaacgctttatatcagcaaatacacagagaaatccaagatgaactggtcc
cattatgccgttggcttatggttctatagccagctcaatatactagtgtatctaagagtg
caacgagaaaatactacagctagagtgttgcccatattggtaatggttttggcttcctgg
gatcaatacaaaaaccatgtagtcctatcaaaactgaaaaaatacagtctaccaaggtct
cgactctttgaattggtttgttgcccccattacttagatgaaatgatcatttatggctct
cttgtctcttatggacacgaatttgtatggccattgatctgggtaatcgccagtctaagc
atttcagctttagaatcaaggaagttctatctttcaaaattcaaagatacagaagttcct
cgttacgcagctattccatacatcttatag

DBGET integrated database retrieval system