KEGG   Candida glabrata: CAGL0L00847gHelp
Entry
CAGL0L00847g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cgr  Candida glabrata
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CAGL0L00847g
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CAGL0L00847g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:complement(106031..106888)
Genome map
AA seq 285 aa AA seqDB search
MDGIKILATFSVLVLFYKLFTYSKKGGVSQKEAVKALLKTEFREFELVEKEQLTHNTAKY
KFKLADESHVLGLPIGQHITVKTIIGGKPVSRSYTPTSLDEECVGFFELLVKSYPEGNIS
KHIGDMKIGEKINISGPRGFYEYVPNVHKHLAMVAGGTGITPMFQIMKAIARDPSDKTRV
TLLYGNVLEEDILLKQELDDLVKQRPDQFKITYLLDKPERDDWEGGVGYVTLDLMKESFP
SAEEDVQLLVCGPPGMVSSVKRNAVALGFPRAKPVSKMEDRVFVF
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggatggcataaagattttggcgacgttctcggtactagtactgttctacaagcttttt
acgtacagcaagaaaggtggtgtttcacagaaggaggctgtgaaggcactgttgaagaca
gagtttagggagtttgagttggtagagaaggagcaattgacacataacactgcaaaatac
aagttcaagctcgcagatgagtcacatgtgttggggttgccaattggtcagcatatcact
gttaaaaccataattggtggcaagccagtgagcagatcatacacgccaacctctctggac
gaagaatgtgtcgggttctttgagttgctagtcaaatcttatcctgaaggtaatatctcc
aagcacattggtgacatgaagattggtgaaaaaatcaacatatctggtcctagaggattc
tacgagtatgtgccaaatgttcataaacaccttgccatggttgctggtggtactggtata
actccaatgtttcaaataatgaaggctattgcccgggaccccagtgataagaccagagta
actttgctgtatggtaacgtgctagaagaggacatacttttgaagcaagaattggatgac
cttgtcaagcaaagaccggatcagttcaagatcacctatcttcttgacaaaccggagcgt
gacgactgggaaggcggtgtaggctacgtgacattggatctcatgaaggaatccttccca
tctgcggaagaggacgttcaattgctcgtctgtggtccgccaggcatggtttcttctgtc
aagaggaacgccgtcgctctcggattcccaagggccaagcctgtctcaaagatggaagac
cgtgtgtttgtcttctga

DBGET integrated database retrieval system