KEGG   Candida glabrata: CAGL0L01639gHelp
Entry
CAGL0L01639g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
cgr  Candida glabrata
Brite
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CAGL0L01639g
Peptidases [BR:cgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CAGL0L01639g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:178104..181547
Genome map
AA seq 1147 aa AA seqDB search
MENITSNEGIPDLNEELNTIQIESTSSNDGHEELLRKRGIITKLMKNCELSAKEGDKVYI
IPKDWFDKFFSEELKSENDLGPIDVASIIKDYEHFVLEDYNSVPYTSVPEPLFLQFQEWY
GITDLSQPVVTYLIENENGELVTEYNKRIFRLHHLTIGESSRNNYTLNQSYIVLSSLNLY
SDLKVKAIQQFAKNQNYLNMENHEFRVWVVEDNETNSANTALSSYEITPLQFLSLSSKEL
IAEDMFHKLLKSTSSQPCDIIIETRNLNDGKWPSYFFMYNNPMTMTGIVGLSNLGNTCYM
NSGLQCLVHIPKLRDYFFYGGYEQEINLDNPLGYNGTVATAFGNLIQNLYSYHWNQQQYQ
SYSPNRFKMTLGQANSMFAGYMQQDSQEFLAFLLDSLHEDLNRIHDKPYIEKPTLETSEE
LADENAVKQLAKKTWDAHLARNDSVINDLFVGMYKSTLKCPTCKNISITFDPYNDLTLPL
PISTVWNKKVKIFPQKSPPCILEVELPKSATYNDLKDYVATYSNIDSSSLFGCEIFNHQF
YRNFESPISDSNYLPVQELISETDDIIFYEIIINPGDIILPVINTRIEEGFNSPSLFGVP
FFVTVSDEERRNPFLIYQKLEKLYTNLSGGYIQLRETLNNENQLNAIFPNLVAKYGKEDM
EPINDIIDTLYDPNDSTDGIFTLKTISESRDEIEIESPSKTQPWIPESNINYKLADDIFN
FSSVILRDIYYYNKMENQTSDAENASSTDNSNSEDNMEISTDSPVVDGSDLGNSESNHKP
EKYQSELDKLCIESSSILVCEWTQKSIDEVFTDDKPIDWEHPALLENKELLLAQKQRNSA
SPNIITLDSCLKLFSKPEVLGINDSWYCPKCKEHRQATKQLELWNTPEILLIHLKRFENQ
RSFSDKIDAVVDFPIEGLDMTPYVVDSVVEDGCIYDLFAVDNHYGGLGGGHYTSYVKNNI
DNRWYYFDDSRVSSTDPKKSVAGSAYLLFYCKREQNPNGIGNSKLQDIIINSRTKYEERW
QEILNSQTQLYESTKDIVSQETSLNIGYTPDSKNKSYEIEPNNSPSLTNSHSDTTESETF
ELKQDKNGSESSEDDILSRKSTGYSTESLEVGNLDINEADENGGRRKLRLLKKVYGSDTN
PEDEDEC
NT seq 3444 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacattactagtaatgaagggatcccagatcttaatgaagaactgaacacgatt
caaattgaaagtacgagcagtaatgatggacatgaggagctacttagaaagcgtggcatt
ataactaaattgatgaaaaactgtgaattgtcagccaaagaaggtgacaaagtatacatc
atccctaaagattggtttgataaattcttttctgaagaattgaaatctgaaaatgattta
gggcctattgacgttgcatctatcattaaagattacgaacattttgtccttgaagattat
aatagcgtgccatatacatcagtgcctgaaccgttattccttcagtttcaagaatggtat
ggtatcactgacctatctcaaccagtagttacttatctcattgaaaatgaaaatggggag
ttagttactgagtataacaagaggatcttcagattgcatcatttaactataggtgaatcg
tccagaaataactacactttgaatcaatcttatattgttctctcatcattgaatctttat
tctgacttgaaggttaaggctatacagcaatttgcaaaaaatcaaaactatcttaatatg
gaaaatcatgaatttagggtatgggttgtagaggataacgagacaaactccgctaacacg
gcattgagtagttacgagattacgccattgcagtttttaagtttatcatcaaaagaacta
atagcagaagacatgttccataaacttcttaaaagtacgtcatcccagccctgcgatatc
ataattgagactcgaaatttaaatgatggtaaatggccttcctatttttttatgtataac
aatcctatgactatgacaggaatagtcggactgtcaaatctgggaaatacctgttatatg
aattcaggtcttcaatgtctggtacatatccctaagctaagagactatttcttttatgga
ggctatgagcaggaaatcaatcttgataatcctcttggctacaacggaacagtcgctact
gcatttggtaacttgatacaaaatttatattcttatcattggaaccagcagcaatatcag
tcctattctccaaaccgatttaaaatgacattaggtcaagccaatagcatgtttgcaggt
tatatgcaacaagattcacaagagttcctagccttcctattggatagtctacacgaggat
cttaatagaattcatgacaagccttatattgaaaaacctactttggaaacttctgaggaa
ttggctgatgaaaacgcggtaaagcaacttgcaaagaagacttgggatgctcacctcgct
cgtaatgactctgtgataaatgatttatttgttggtatgtataaatcaacactgaaatgt
ccgacttgtaaaaatatctccattacctttgatccatataatgatctgactttgccattg
ccaatatcaacagtatggaataagaaagtgaaaatctttccccaaaagtcaccaccatgt
attcttgaagtagaactccccaagtcagcgacatacaacgatttaaaggattatgttgca
acatattccaatattgattcaagttcattattcggttgcgaaatttttaatcaccaattt
tatcgaaattttgagtcccccatttcagactcaaactacttaccagtgcaggaattgatt
tctgaaactgatgacatcatattttatgaaattattatcaatccgggtgacattatctta
cctgttataaataccagaattgaagaaggattcaatagcccatccttatttggagtgcca
tttttcgttacagtgtcagatgaagagagaaggaatccattcttgatataccagaaactg
gaaaaattatatactaatctgagtggtgggtatatccaattaagggagactttaaataat
gaaaatcaactaaatgcaattttcccaaatctagtagccaagtatggaaaggaagatatg
gagccaataaacgatattattgacacattatatgatccaaatgactccacagatggtatt
ttcactttgaaaacgatatcagaaagcagagatgaaattgaaattgaatcgccatcaaaa
acccagccttggattccagaaagtaatattaactataaacttgcagatgatatattcaac
ttctcatcagtgatcttgagagatatctactattataataaaatggaaaatcaaacaagt
gatgctgagaacgcttcatcaacagataattcaaactccgaggataatatggaaatttct
actgatagcccagttgtcgatgggtctgacttaggaaatagtgaatctaatcacaaacct
gagaaataccagtctgaattagataaactttgtattgaaagcagttcaattttagtttgc
gaatggacacaaaaatcgattgatgaagtatttactgatgataaacctattgattgggaa
catcccgcccttcttgagaataaggaattgttactagctcaaaagcagagaaattcagca
agcccaaatatcataacattggatagctgtttaaaacttttttctaagccagaagtttta
ggaattaacgactcatggtattgtccaaaatgtaaagagcataggcaagctactaagcag
cttgagttatggaatacgccagaaatactgctaattcacttaaaacgttttgagaatcaa
agatccttcagtgataagatcgacgcggttgtcgatttccccatagaaggattggacatg
acaccttatgttgttgattcagttgtagaggatggttgtatctatgatctctttgcagtt
gataatcattatggtggtctcggcggtgggcattatacatcttatgttaaaaataacata
gataacagatggtattattttgatgattcaagagtctcatcaactgatccaaaaaaaagt
gtagcaggttctgcctatttgttgttttattgtaaaagggaacagaatcctaatgggatt
ggcaactcaaagttacaggatattattatcaattcgagaactaaatatgaagaaagatgg
caagaaatattaaactcacagactcaactgtatgaatctacaaaagacatagtaagccaa
gagacatccttgaatattggatatacgcctgattctaagaataaatcgtatgagattgaa
ccgaataactcaccttctttgaccaacagccattcagacaccacagaaagtgagactttt
gagctaaagcaagataaaaatggttctgagtccagtgaggatgatattttgtctcgaaaa
tcaactggttacagtacagaaagtcttgaagtcggaaatcttgacatcaatgaggcagat
gaaaatggaggtagacggaaattacgtttgttaaagaaagtatacgggtcagatacaaat
ccagaagatgaagacgagtgttaa

DBGET integrated database retrieval system