KEGG   Candida glabrata: CAGL0L01925gHelp
Entry
CAGL0L01925g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cgr  Candida glabrata
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CAGL0L01925g
   00052 Galactose metabolism
    CAGL0L01925g
   00500 Starch and sucrose metabolism
    CAGL0L01925g
   00520 Amino sugar and nucleotide sugar metabolism
    CAGL0L01925g
Enzymes [BR:cgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CAGL0L01925g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:225386..226894
Genome map
AA seq 502 aa AA seqDB search
MSTAKKHTKTHSTYAFESNTNSVAASQMRNALNKLADSIGSEHGDDARTRFENELDSFFT
LFRRYLVEKSSSNTLEWDKIKSPNPEEVVRYDTINSQAENVSSLSKLAVLKLNGGLGTSM
GCVGPKSVIEVREGNSFLDLSVRQIEHLNRQYDSDVPLLLMNSFNTDKDTEHLIKKYSAN
RIRIRSFNQSRFPRVYKDSMLPVPETYNDPKDAWYPPGHGDLFESLHASGELDALIAQGR
EILFVSNGDNLGATVDLKILNHMIETGAEYIMELTDKTRADVKGGTLISYDGQVRLLEVA
QVPKEHIDEFKNIRKFTNFNTNNLWINLKAVKRLVESSALEMEIIPNQKTITRGGQEINV
LQLETACGAAIRHFSGAHGVVVPRSRFLPVKTCSDLLLVKSDLFYLQHGALKLDPSRFGP
NPLIKLGSHFKKVSDFSARIPHIPKLVELDHLTITGNVFLGKGVTLRGTVIIVCSDGQKI
DIPNGSVLENVVITGNLQILEH
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgctaagaaacacacaaagacacattctacatatgcattcgagagcaacacc
aacagtgttgctgcatctcaaatgagaaacgcgctaaacaagttagcagactcaattggc
tctgagcacggtgacgatgcccgtacccgtttcgagaacgagttggactctttcttcact
cttttcagaagatacttggtcgagaagtcctcttctaacactttggagtgggacaagatc
aagtcccctaaccctgaggaagttgtccgttacgacactatcaactctcaggctgagaac
gtctccagcttgtctaagctagctgtgctgaagttgaacggtggtctaggtacctctatg
ggttgtgtcggtccaaagtccgtgatcgaagttagagaaggtaactccttcttggacttg
tccgttagacagatcgagcacttgaacagacaatacgacagtgacgtgccattgttgcta
atgaactctttcaacaccgacaaggacacagaacacttgatcaagaagtactctgctaac
agaatcagaattagatctttcaaccaatccagattccctcgtgtttacaaggactccatg
ctgcctgtcccagaaacttacaacgatccaaaggacgcttggtacccacctggccatggt
gacttgttcgaatccctacacgcttccggtgaattggacgctttaatcgcacaaggcaga
gaaatcttattcgtatccaacggtgacaacttgggtgccactgtcgacctaaagatccta
aaccacatgatcgaaacaggtgccgaatacatcatggaattgaccgataagaccagagcc
gatgttaaaggtggtactttgatctcttacgatggccaagtccgtctattggaagtcgcc
caagttccaaaggagcacattgatgaattcaagaacatcagaaaattcaccaacttcaac
accaacaatttgtggatcaacttgaaggctgttaagagattagtggagtccagcgctttg
gaaatggagattattccaaaccaaaagaccatcaccagaggtggtcaagaaatcaacgtt
ctacagctagaaaccgcctgtggtgccgccatcagacactttagcggtgctcacggtgtt
gtcgtcccaagatcaagattcttgcctgtcaagacatgctctgatttgctgctagtgaag
tccgatctattttacttgcaacatggtgctctaaaattagatccatcaagatttggtcca
aacccattgatcaagttgggttcccacttcaagaaggtctctgatttcagcgccagaatt
ccacacattccaaaactagtggaattggatcatttaaccatcacaggtaacgtgttctta
ggtaaaggtgtcactctaagaggtaccgttatcatcgtttgctcagacggtcaaaagatc
gatattccaaacggttccgttctagaaaatgttgtcatcactggtaacttgcaaatcttg
gaacattga

DBGET integrated database retrieval system