KEGG   Candida glabrata: CAGL0L02431gHelp
Entry
CAGL0L02431g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cgr  Candida glabrata
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CAGL0L02431g
Enzymes [BR:cgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CAGL0L02431g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:complement(274928..276934)
Genome map
AA seq 668 aa AA seqDB search
MQNIFFQLFIILFTIVRVYSEEIYPDPLSSNDFYSLIKDGNLHLIEFYSPYCSYCNHLAP
TWKKTWEKAQEINLLANYNVTLDRVNCIENGDLCYDEKIDYFPSFRLYGPSGFIKYYPED
DKKTVNEFLKFVKQASKDKTNFQEKGQKDKSLALTELAFNELLNDPNLNHPYLISFWPTK
QLISTDDDIDFENCYECLPFQRSWNLLSNTLDEKNIKTAHVNCESAVNLCKAMGYKDLTE
IKNHRGDRMAKVALLVPGRPHSKNKVIRYNEEYFTDYLKVKDFAIRGVENAKVPDFNSNY
ISNYPVIDVTSYFEPESTDLESFVIYVNDRLDESDDQLLDSLIEVVSNAERTTLYKANVE
DFYAAMGPELENFYGKYYNDKEYTFKDLIQLKLSTNLPAIYYIQKGQIKTSIFPVKKSLS
NDKFTKGVQKWLNLFNIPLLTDITSWKFSKLMNYDKSNHRFILTELVDTSLIGVDKEIDS
KLQKYHELQNIYEIEVDNWYLRQNSLPEGQEQRKIAIGKLRDKRKAGLITTFLDISEAKS
FATRNGLVSSSRQYEIGDVIIIDRASGYVYNSYNDGESISVTNTNKILHALLSAQFSIPA
DTKFAGRLLGSPFPGPLKFMDTIHQYGVFGYITILVLIALLWNLKRILKLTKRPASVSNG
IQKDGKYY
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacatatttttccaattatttataatactattcacaatagtacgagtctacagt
gaggaaatatacccagaccctctatcgagcaatgacttttattcactgataaaggatgga
aaccttcatctaatagagttttatagtccttattgttcctattgtaatcatttggctccg
acttggaaaaagacctgggagaaagcccaagagataaatttacttgctaattataacgtc
acactggatagagttaattgtatagaaaatggtgatctatgctatgatgagaagatcgac
tatttccctagctttaggttgtatgggccttctggcttcatcaaatactatcccgaggat
gataagaagactgttaatgagttcttaaaatttgtgaagcaggcctcaaaggataagacg
aatttccaggaaaaaggtcagaaagataaaagtctggcattaacagaattagcctttaac
gaattgctgaatgatccaaaccttaaccatccatatctaatatccttttggccaacaaaa
caattgatcagcacagatgatgatattgattttgaaaattgttatgaatgtttgccattc
caaagatcttggaatctgctatcaaataccttagatgagaaaaacattaagactgcacat
gtgaattgtgaaagtgcagtgaatctatgtaaagcaatgggttataaagatttgacagag
attaagaaccatagaggtgataggatggccaaagttgccctgctcgtacctggtagacca
cattccaagaataaggtcattagatacaatgaagaatactttactgactatttaaaggtc
aaggattttgcaattagaggagttgaaaatgcaaaggtacctgatttcaactcaaattat
attagtaattacccagtaattgatgttactagctatttcgaaccagaatctacagatttg
gagtcctttgttatatacgtcaatgatagattagatgaaagtgatgatcagcttctggat
agtctaattgaagttgtgagtaacgcagaacgtactacactttataaggctaatgtagaa
gatttttacgccgcaatggggccagagctagaaaatttctatgggaaatattacaatgac
aaagaatacacattcaaagatctaattcaactgaagctatccacaaatttacctgccatt
tactatattcaaaagggtcaaataaaaacatctatttttcctgtgaaaaaatccttgtct
aatgataaattcactaaaggtgttcaaaagtggcttaacttatttaatattcctttattg
accgacattacttcttggaaatttagtaagctaatgaactatgataaaagcaatcatagg
tttatattaaccgagctagttgatacatcattaataggtgttgataaagaaattgattcc
aaactgcaaaaataccatgaacttcagaatatttatgagattgaagtggataattggtat
ttgaggcaaaactctctgcctgaaggacaggaacaaaggaaaatagcgattggaaaatta
agagataaacgtaaagcaggtttgattactacatttctggacatttccgaagcaaaatcc
tttgcaacaagaaatggtcttgttagttcaagtaggcaatatgaaattggtgacgtgatt
atcattgatagggcttctggatatgtttacaatagttacaatgatggagagtcaatatca
gttacgaacacgaataaaatactgcatgctctattatctgcacaatttagtattcccgcg
gacaccaaatttgcaggtagattgctaggctcgccattccctggaccattgaaattcatg
gatacgatacaccaatatggtgtatttggttatattaccatactagttctgattgctctg
ctgtggaacttgaaaagaattctgaagttgacgaaaaggccagctagtgtatccaatggg
attcaaaaagacggtaaatattactaa

DBGET integrated database retrieval system