KEGG   Candida glabrata: CAGL0L03982gHelp
Entry
CAGL0L03982g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cgr  Candida glabrata
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:cgr01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cgr00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cgr00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:complement(466897..468561)
Genome map
AA seq 554 aa AA seqDB search
MVKISLDNVKLLVDIDDKPQFEPSKTTVKTILTKEALEFIVLLHRTFNARRKQLLENRQE
VQKKLDSGNFKLDFLPETANIRNDPTWQGPTLAPGLIDRSTEITGPPLRNMLINALNADV
KTYMTDFEDSASPTWLNQIYGQVNLYDAVRNQIDFKTPRKEYKLRDRFENLPTIIVRPRG
WHMVEKHLYVDDEPISASIFDFGLFFFHNAKELIKLGKGPYFYLPKMEHHLEAKLWNDIF
NVSQDYIAIPRGTIRATVLIETLPAAFQMEEIIYQLRQHSSGLNCGRWDYIFSTIKRLRN
LPEHVLPNRDLVTMTSPFMDAYVKRLINTCHRRGVHAMGGMAAQIPIKDDPVANEKALAK
VRNDKIRELTNGHDGSWVAHPALAPICNEVFINMGTPNQIHFVPENEVTAQDLVNTNITD
AAVTLDGIRQNLDIGLQYMEAWIRGSGCVPINNLMEDAATAEVSRCQLYQWVHHGVKLSD
TGDKVTPDLTQKILEERVQKLSKESPLGDKNKFALAAKYFLPEIRGEKFSEFLTTLLYDE
IVTANSSATDLSKL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggttaagatttcattggacaacgttaagttgttggttgacattgatgacaagccacaa
ttcgagccatccaagactactgtcaagactatcttgactaaggaagccctggagttcatt
gtcttgttgcacagaacattcaatgctagaagaaagcaattgcttgagaacaggcaagag
gtccaaaagaaattagacagcggcaacttcaagctggactttttgccagagacagctaac
attagaaatgaccctacatggcagggacctacattagctccaggtttaattgacagatct
actgagatcactggtcccccattgagaaacatgttgattaatgctttgaacgccgatgtc
aagacttatatgactgattttgaagattctgcttcaccaacttggctaaaccaaatatac
ggtcaagtcaacctgtatgatgctgtgaggaaccaaattgattttaagactccaagaaag
gaatataaattaagagacagatttgaaaaccttccaacaataattgtcagacctcgtggc
tggcatatggttgaaaagcacttatacgtggatgacgaacctatcagtgcttctatcttt
gatttcggtttgttctttttccacaatgcaaaggagttgatcaagctaggaaaaggtcca
tacttttacttgccaaagatggagcatcacttggaggccaaactatggaatgatatcttc
aatgtttctcaagactacatcgctattccacgtggtaccattagagcaactgtgttgatt
gagactttgcctgctgctttccaaatggaagagattatttaccaattgagacaacattcc
agtggtttgaactgtggtcgttgggactacatcttttctactatcaagaggttgagaaac
ctacctgaacatgtcttaccaaatagagatttggttacgatgacctcaccatttatggat
gcatatgtcaagagattgatcaatacttgtcatcgtagaggtgttcatgccatgggtggt
atggctgcccaaattccaattaaggatgatccagttgcaaatgaaaaggctctagctaaa
gtccgtaacgataaaatcagagaattgaccaatgggcatgatggttcatgggttgcccat
ccagctttagctccaatttgtaacgaagtctttattaacatgggcactcctaaccaaatt
cattttgtgcctgaaaatgaagttaccgctcaagatttggttaacaccaatatcactgat
gctgcagttacactggacggtattagacaaaacctggacattggtctacaatacatggaa
gcttggatcagaggatctggttgtgtccctatcaacaacttaatggaagatgcagctaca
gcagaagtttcccgttgtcaattataccaatgggttcaccatggtgtaaagctaagtgat
actggtgacaaggttacaccagatctaactcaaaagattctagaggagcgtgttcaaaaa
ctgtccaaggagtctccattgggtgataagaataaatttgcacttgctgccaaatacttc
ctacctgaaattagaggtgaaaagttcagtgaattcttaaccacgcttctatatgatgaa
attgttactgctaactcatctgcaactgatctaagtaagttgtga

DBGET integrated database retrieval system