KEGG   Candida glabrata: CAGL0L04554gHelp
Entry
CAGL0L04554g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
cgr  Candida glabrata
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cgr00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:complement(526735..528417)
Genome map
AA seq 560 aa AA seqDB search
MRHEVAVRATVTDAGIKIKSQTRGFCCPEVVHKPQGLSSILGGCFLSCCAPLGVNDAELS
LDPDNSTFSMDEDIAEAPTVSDTIPFGRILGARYRDSSANSQTHETEGLLHGIGHQRYID
LTYACMKDHHVVPCTVPLQIDYVPMAHENPDLVELIIEKSYQNVKRNRSILVIINPHGGK
GKAMHIFKKRIEPILIASECSFELMETKYSRHATDIAREIDLEEFDTIACASGDGVPYEV
INGLYMREDKVDAFNKITVTQLPCGSGNAMSISCHWTDNPSFAALCLVKSVESRIDLMLC
TQPDSEDPEPKLSFLSQTYGVIAESDINTEFIRWMGPLRFDIGVAFNVLQKKCYPCDIYV
KYAAQSKRELSVHYTKNKTTQYLEFENLITETDTESSDSGIPVENITEENLRIKYPVEDG
IPNDWVKLDDEIGNNLSVFYTGKMPYVAANTKFFPAALPADGTFDMIIMKANLPVAKSFP
ILLSIDKGEHVLDSEVIHSKVLAYKIIPKIENSLISIDGERFPCKPLQVEVLPKLCKTLL
RNGKYIDTDFDMLCADTKLP
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgagacatgaagttgctgtgagggccacagtcactgatgccggtataaagattaagtct
cagaccagagggttttgctgtcctgaagtggttcataaaccacaggggttatcctccatt
ctcggtgggtgtttcttatcttgctgtgcaccgttgggagtcaatgacgcagaactctct
ttagacccggacaattccaccttctccatggatgaggacatcgctgaagcaccgacagtt
tccgatactattccctttggcaggattctgggtgcccgctacagggattcaagcgctaat
tcacagactcacgaaactgaggggttgctgcacggtatagggcatcaacggtacattgac
ttgacttacgcatgcatgaaggaccaccatgtggttccttgcacagtgccgttacagatt
gattatgtaccaatggctcatgagaacccagacttggtggaattgataatagagaaaagt
tatcaaaatgtcaagagaaatagatcaattcttgtcataattaatccacacggtggtaaa
ggcaaagcaatgcatatattcaaaaagagaattgaaccaatattgatcgctagtgaatgc
tcctttgaattaatggagactaagtactccaggcatgcaactgatattgcacgagagata
gacctagaggaattcgacactattgcttgcgcttcaggggatggtgtaccatatgaagtt
attaacggattatacatgagagaagataaagtggatgcttttaataaaattacagtaaca
caattgccttgtggatcaggtaacgccatgagtatatcttgtcattggacagacaaccca
tcgtttgccgcgctatgccttgtgaagtctgtcgagtccaggattgatttaatgctatgt
actcaacctgactccgaagatcctgaacctaaattgtcgtttctaagccaaacatatggt
gtgatcgctgaatctgatattaatactgagtttataagatggatgggccctctaaggttt
gacattggcgtggcatttaacgttctacagaagaaatgctatccatgcgatatctatgta
aaatatgcggctcaatccaaaagagaactgtctgtacattacaccaaaaataaaaccaca
caatatttggagttcgaaaatctcattacagaaacggatactgagagctccgattctggt
ataccggtggagaatattacagaagaaaatctcaggatcaagtatcctgttgaagatggc
atccctaatgattgggtcaaacttgatgacgaaataggtaataatttgtcagttttttac
actggaaagatgccttacgtagctgcaaacacaaagttcttccccgccgcactaccagcg
gatggtacattcgatatgatcataatgaaagccaacttacctgttgctaaatcctttcct
atattgttgtcgattgataaaggagagcatgttctcgattcagaagttattcacagtaaa
gttttggcctataagattattccaaagatagaaaacagtctaatctcaatagatggtgag
agattcccttgtaaaccactacaggttgaagtattaccaaagctgtgtaaaacattactg
aggaatggtaaatatattgatactgacttcgatatgctatgtgctgatacgaaactacca
taa

DBGET integrated database retrieval system