KEGG   Candida glabrata: CAGL0L05632gHelp
Entry
CAGL0L05632g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
cgr  Candida glabrata
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CAGL0L05632g
Enzymes [BR:cgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CAGL0L05632g
Protein kinases [BR:cgr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CAGL0L05632g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:612478..614511
Genome map
AA seq 677 aa AA seqDB search
MERVRLDRKSSNDSNHSLGGESTSRSGGSGIGVAPTSGNNGTVKRASSMSSNYSNINASL
HARVKAFQEQRGLHRSSSLGKGDSEENIGNVGTSINPSPSLGSMKDEPVPAIQKIVNKPL
PPLPGQNSSSLTPSQETINMISNASQQAPDGPLNNISPVPGFKEAMGGNVRRNDGQNLYG
STSPAVTASAPNMPAFNPNRKAPRPPQIPHNTVIPAKPMQSLSSRRGLKLPPGGMKLKLP
SKGDAPASMPSTVPAASSVKPVVHQEFAATPSNKNHIKNNNGSTEGKRSNPGSLVNAVQT
TSISSANDQQDTEGTEPKSNSNGTGLFANFSRYVDIKSGSLNFAGKLSLSSRGIDFSNGS
SSRITLDELQFIEELGHGNYGTVSKVLHKPNNVLMAMKEVRLELDESKFRQILMELEVLH
KCNSPFIVDFYGAFFIEGAVYMCMEYMDGGSLDKIYDENPEMGGIDEPQLAFITNAVIQG
LRELKEVHNVIHRDVKPTNILCSAKQGTVKLCDFGVSGNLVASLAKTNIGCQSYMAPERI
KSLNPDRGTYTVQSDIWSLGLSILEMALGRYPYPPETFDNIFSQLSAIVDGPPPKLPADK
FSDEAQDFVSLCLQKIPDRRPNYSNLYEHPWLAKYRSIDVQMGPYITKRLEIRKRILAEK
GEDGLHRTVPALHKGGL
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggagagggtgcgattggacagaaagagcagtaatgacagcaatcatagtctgggagga
gaatctactagcagaagtggaggatcaggtattggtgttgcccccactagtggcaataat
ggtactgtgaaaagagctagttcaatgtcatcaaactacagtaacataaatgcctcttta
catgcgcgtgtgaaagcattccaagaacaaagaggtctacataggtctagcagtttgggg
aaaggagattcggaagagaacattggaaacgtaggtacaagtataaatccttctcctagc
ctcggatctatgaaagacgagccagtaccagcgattcaaaaaattgtaaataaaccacta
ccgccattgccgggtcagaatagttcctcgcttacaccttcccaggaaacaatcaatatg
attagcaatgcttctcaacaggcaccagatggtccactcaataatatttcacctgttcca
ggatttaaggaagctatggggggcaatgtaagaagaaatgacgggcaaaatctttatggt
tctacaagtcccgcagtaacagcctcggctcctaatatgcctgcttttaatccaaataga
aaggcaccaagacctccccaaattcctcataatactgtgataccagcaaaacctatgcaa
agtctgagttcaagaagaggtctgaaattaccgcccggtggaatgaaactgaaactacct
tcaaaaggtgacgcgccagcatctatgccaagtacagttcctgcagcttcatcagtgaaa
ccggttgttcatcaagaatttgccgccactccatcaaataagaatcacataaagaataat
aacggaagcactgagggtaagaggtcaaatccaggttccttagtgaacgcagttcaaact
acatctatttcatcagctaatgatcagcaggatacggaaggaactgaaccaaaaagcaac
tctaatggtactggtctgtttgcaaacttttcgcgatatgtggatattaagtcgggctct
ttaaattttgctggtaagctttcactttcctcaagaggtattgattttagcaatggttct
agttcaaggataacacttgatgagcttcaatttatagaggaactgggacatggtaattat
ggtactgtgtcaaaagttttacataagccaaataatgttttgatggcaatgaaagaagtt
agacttgaattagatgagtctaaatttaggcaaattttaatggaattagaagtgcttcat
aaatgtaactcaccatttatcgtggacttctatggtgcattttttatagagggtgctgtt
tatatgtgcatggaatatatggatggtggatcattagataaaatatacgatgaaaacccc
gaaatgggtggtattgatgagccacaacttgcatttatcactaacgctgtcattcaaggt
ttgagggagctaaaagaggttcataacgtgatacatcgagacgtaaagccaaccaacatt
ctgtgttctgccaagcaaggaactgtgaaattgtgtgattttggtgtttctggtaatctg
gtagcttccttagcgaagacaaatataggttgtcaatcatatatggctcctgagagaata
aaatctctgaaccctgatagaggaacatatacagtgcagtcagacatatggtcattgggt
ctaagtatactagagatggcattaggtagatatccttatcctccagaaacattcgataat
atattctcgcaactaagtgcaatcgtagatggaccaccccctaaactgccagcagataag
ttcagtgatgaggcccaagacttcgtgtcgttgtgtctgcaaaagatccctgatagaaga
cccaattattctaatctgtatgagcatccatggctagcaaaatatcgtagcatcgacgtc
caaatggggccatacattactaaaagattagaaatccggaaaagaatactagctgaaaag
ggtgaggacggtcttcacaggacagtacctgcattgcataaaggtggtttgtaa

DBGET integrated database retrieval system