KEGG   Candida glabrata: CAGL0L09273gHelp
Entry
CAGL0L09273g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cgr  Candida glabrata
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:cgr01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cgr00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:complement(1006160..1007875)
Genome map
AA seq 571 aa AA seqDB search
MLRNYPKNLIGPRTIARTTHTSCYNGGSIKTYVEDQVKAVTEWFGSDRFQNIKRTYTPLD
VVKHRGSINPCEVIYPSAFPSRKLFSLVEEHFKDKKPLHTLGVLDPVQMTQLSRCEDLKV
AYVSGWACSSTMVGSTNDVSPDFGDYPYNTVPNQVERIMKAQQMHDRKAYLEKFMTDQKS
SSNAEFIDYLKPIIADGDMGHGGPTTVMKVAKLFAEKGAAAVHLEDQLVGGKRCGHLSGA
VLVPTGAHLSRLISTRFQWDIMGTENLILARTDSCNAKLISSDIDPRDHSFIQGILNPSK
TDRWADKLLELERKEVDKSIIAEAEKEWYDQNKLYTYEEMIQIRFTESEYKDYLTRKDKY
LQTQGKNFLSVREMKNIATEVNSTKRLEFCWMAPRTKEGYYMFKGGMEPAIRRSLVFAPY
SDMIWLETKTPDLEQAKSFSKEIHNTYPHVKFVYNLSPSFNWTAHGFNGDKLKSFIWDLA
KEGFVLQLVSLAGLHTNAASFWDLAKNFQKDGMKAYVDKVQKIEKQLDCDVLTHQKWSGA
EYMDSLLNVVQNGSSSQTMSTSGESFTENQF
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtaattatcctaagaacttaattggacctagaacaattgcaaggactacacac
acctcatgttataatggtggaagtataaaaacatatgttgaagatcaggttaaggcagtt
accgaatggtttggaagcgatagatttcaaaatattaagagaacgtacacacctttagat
gtggtaaaacatcggggtagcataaatccctgtgaagtaatttatccatctgcgttccca
tcaaggaagttgttttccctagtagaagagcactttaaagacaaaaaaccattgcacact
ttgggtgttttagatcctgtccaaatgacccaactaagtagatgcgaagatttgaaagtg
gcatatgtatctggatgggcctgctcctctacaatggttggttcaaccaatgatgtgtca
ccagattttggagattatccatataatactgtacccaatcaagtggagaggattatgaaa
gcacaacagatgcatgaccgtaaagcttacttagagaaatttatgacagatcaaaaatcc
tcatcaaatgctgaatttattgattatttgaaaccaattattgcagatggtgatatgggc
catggcgggccaacaacagttatgaaggttgcaaaactttttgctgagaaaggtgctgct
gctgtccatttagaagatcaacttgttggtggtaagagatgtggtcatctaagtggtgct
gttttagttcccactggtgcacatctgagtcgcttaatcagcaccagatttcaatgggat
attatgggcactgagaacttaatactagctcgtactgattcatgtaatgcaaaattaata
agcagtgacattgatcctagagatcatagttttattcaaggtatcctcaatccatctaaa
actgatcgttgggcagataagttattagaactagaaagaaaagaggtagacaaatccatc
attgctgaagcagagaaggaatggtatgaccaaaacaaattatatacctacgaagagatg
atccaaataagattcactgagtcagagtataaggactatctaacaagaaaggacaagtac
ctacaaactcaggggaagaacttcctaagtgttcgtgagatgaaaaatatagctacggaa
gttaactccactaaacgcttggaattttgttggatggcacccagaactaaggaaggctat
tatatgtttaaaggaggtatggaacctgctatcagaagatcactagtttttgccccatat
tctgatatgatttggttggagacaaaaacccccgaccttgaacaagctaaaagcttttcg
aaagagattcataatacttatccacatgttaaatttgtctataacttgtcacctagcttc
aactggactgcccacggattcaacggtgacaaattgaaatcgtttatatgggaccttgcc
aaagaaggatttgtcttacaattagtttccttagctggtcttcacacaaatgctgcttca
ttctgggatcttgccaagaatttccaaaaggatggaatgaaggcctacgtggataaagta
caaaagatcgagaaacagctcgattgtgacgtcttaacacaccagaaatggtcaggtgca
gaatatatggactctttgctaaacgttgtacagaatggatcttcttctcaaaccatgagt
acttctggtgagagttttaccgagaaccaattctga

DBGET integrated database retrieval system