KEGG   Candida glabrata: CAGL0L10758gHelp
Entry
CAGL0L10758g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cgr  Candida glabrata
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAGL0L10758g
   01230 Biosynthesis of amino acids
    CAGL0L10758g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAGL0L10758g
   00030 Pentose phosphate pathway
    CAGL0L10758g
   00051 Fructose and mannose metabolism
    CAGL0L10758g
   00052 Galactose metabolism
    CAGL0L10758g
  Energy metabolism
   00680 Methane metabolism
    CAGL0L10758g
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CAGL0L10758g
Enzymes [BR:cgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CAGL0L10758g
Protein phosphatases and associated proteins [BR:cgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CAGL0L10758g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:complement(1147396..1150311)
Genome map
AA seq 971 aa AA seqDB search
MTAEALVNGTSYTTLVAHSQESFKNAVEFYKNFLSLMKLNDKNANEATLYNSSVCLKIVL
EEDSSKNQAAMHRVTKLSEMSKKQDWRAQVKDSLVFNIVDIQSIQKSLIANNFPIQAYPT
TLQPMQLFTIDPLGNVVGVTCTKNAASTRPTKPQADVTTVPPSALASNVPSALPSKVQSF
TDLSYCMKTTDHYPSLPTKATRVTPESKKAIAVMTSGGDAPGMNSNVRAIVRSALFKGCR
AFVVMEGYEGLVRGGPEYIKEFSWEDVRGWSTQGGTNIGTARCMEFRERKGRLLGAQHLI
EAGVDALIVCGGDGSLTGADLFRSEWPSLIDELLKENRIDNDQYERYKHLNICGTVGSID
NDMSTTDATIGAYSALDRICTAIDYVEATANSHSRAFVVEVMGRNCGWLALLAGIATSAD
YIFIPEKPATSSEWQDQMCDIVAKHRSRGKRTTIVIVAEGAIANDLTPISPSDVHKVLCD
RLGLDTRITTLGHVQRGGTAVAYDRILATLQGIEAVNAVLESKPDTQSPLIAINENKITR
KPLVESVKLTKSVADAIQAKDFKKAMSLRDTEFIEHMKNFMAINSADHNEPKLSEDKRLK
IAIVNVGAPAGGINSAVYSMATYCMSQGHKPYAIYNGFSGLARHESVRSLKWQDMLGWQS
RGGSEIGTNRVTPEEADLGMVAYYFQKYQFDGLILVGGFEAFESLHQLERARETYPAFRI
PMVLIPATLSNNVPGTEYSLGSDTALNALMEYCDIVKQSASSTRGRAFVVDVQGGNSGYL
ATYAALAVGAQVSYVPEEGISLEQLSQDIEYLAEAFEVAQGREGFGKLILKSTNASKALT
AEKLAEVITAEANGRFDAKAAYPGHVQQGGLPSPIDRTRATRFAIRAVDFIEEQQSVIAN
ARAANDVFVADDKDVESTATVLGVKGSQIVFSSIRQLYDFETEVGKRMPKVIHWQNARAI
ADHLVGRKRVD
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggaagctcttgttaatggtacttcttataccacgctagtggctcactcccaa
gagtctttcaagaatgctgtggaattttacaagaacttcttgtccttgatgaagttgaac
gacaagaacgccaatgaggctactctgtataactcttctgtctgtttgaagattgtccta
gaggaggacagctccaagaaccaggctgctatgcacagagtcaccaagttgtctgagatg
tccaagaagcaggactggagagcccaagtcaaggactctcttgtcttcaacattgtcgac
atccaatccatccaaaagtctttgattgcaaacaacttccctatccaagcatacccaacc
actttgcaaccaatgcaactttttaccatcgacccattgggtaacgttgtcggtgttact
tgcacaaagaacgccgcctccaccagaccaaccaagccacaagctgatgtcaccaccgtc
ccaccatctgctttggcctctaatgtaccatctgccttgccatccaaggtccaatcattc
acagacttgtcctactgtatgaagacaaccgaccactacccatccttgccaactaaggct
actagagtcactccagagtccaagaaggccattgccgttatgacctctggtggtgatgct
ccaggtatgaactccaacgtccgtgctattgtccgttctgctctattcaagggctgtcgt
gcattcgtcgtcatggaaggttacgaaggtttggtccgtggtggtccagaatacatcaag
gaattcagctgggaagatgtcagaggctggtccactcaaggtggtaccaacatcggtact
gcccgttgtatggaattcagagaaagaaagggtcgtctgttaggtgcccaacacttgatc
gaagccggtgtcgatgctttgattgtttgtggtggtgatggttccttgactggtgctgac
ttgttcagatccgaatggccatctttgatcgacgaacttctaaaggaaaacagaattgac
aacgaccaatacgaaagatacaagcacttgaacatctgtggtactgttggttccatcgat
aacgatatgtctaccactgatgctaccatcggtgcttactctgccttggacagaatctgt
accgctatcgactacgttgaagccactgctaactcccactccagagctttcgttgtcgaa
gtcatgggtagaaactgtggttggttagctctattggctggtatcgccacttccgctgac
tacatcttcattccagaaaagccagctacttcttccgaatggcaagatcaaatgtgtgac
attgtcgccaagcacagatccagaggtaagagaaccaccatcgttattgttgccgaaggt
gctatcgctaacgatctaactccaatttctccaagtgatgttcacaaggttctttgtgac
agattaggtctagacaccagaatcacaactctaggtcacgttcaaagaggtggtaccgct
gtcgcttacgaccgtatcttggccactctacaaggtattgaagctgttaatgctgtcttg
gaaagtaagccagacactcaatctccattgattgccattaacgaaaacaagatcactcgt
aaacctttggttgaatctgtcaagttgaccaagtctgttgcagatgctatccaagccaag
gacttcaagaaggctatgtctctaagagacactgagttcatcgagcacatgaagaacttc
atggccattaactctgctgaccataatgaaccaaagttgagtgaagacaagagattgaag
atcgccatcgtcaatgtcggtgcaccagctggtggtatcaactctgccgtctactctatg
gctacctactgtatgtcccaaggtcacaaaccatacgccatctacaacggtttctccggt
ttggctagacatgaaagtgttcgctccctaaaatggcaagatatgctgggatggcaatcc
cgtggtggttctgaaatcggtaccaacagagtcaccccagaagaagctgatctaggtatg
gtcgcttactacttccaaaagtaccaattcgatggtttgatcctagtcggtggtttcgag
gctttcgaatctctacaccaattggaaagagctagagaaacctacccagctttcagaatc
ccaatggttttgattccagctaccctatccaacaacgttccaggtactgaatactcccta
ggttctgacactgctttgaacgctctaatggaatactgtgacattgttaagcaatctgct
tcatctaccagaggtagagcttttgttgttgatgttcaaggtggtaactccggttacctg
gccacttacgctgctttggctgtcggtgctcaagtttcctatgtcccagaagaaggtatt
tctctagaacaattgtctcaagatatcgaatacttagctgaagcttttgaagttgctcaa
ggtagagaaggtttcggtaagttgatcttgaaatctactaatgcttctaaggctttgact
gctgagaagttggctgaagttatcaccgctgaagctaacggcagattcgatgccaaggct
gcttacccaggtcacgtccaacaaggtggtctaccatctccaattgacagaactagagct
actagattcgctatcagagctgttgacttcattgaagaacaacaatctgttattgctaac
gcccgtgctgccaacgatgtatttgttgctgatgacaaggatgttgaatctactgccact
gtattgggtgtcaagggttctcaaattgtcttctcctctatcagacaactatatgatttc
gaaactgaagtcggtaagagaatgccaaaggtcattcactggcaaaacgccagagctatt
gctgaccacttggttggcagaaagagagttgattag

DBGET integrated database retrieval system