KEGG   Candida glabrata: CAGL0L10780gHelp
Entry
CAGL0L10780g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
cgr  Candida glabrata
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CAGL0L10780g
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CAGL0L10780g
   00640 Propanoate metabolism
    CAGL0L10780g
  Lipid metabolism
   00061 Fatty acid biosynthesis
    CAGL0L10780g
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CAGL0L10780g
Enzymes [BR:cgr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     CAGL0L10780g
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CAGL0L10780g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:complement(1151884..1158585)
Genome map
AA seq 2233 aa AA seqDB search
MSDESLYEDSAQKEQYEVTDYSSRHQVLPSHFVGLNTVEKVEDSPLKEFVKAHGGHTVIS
KVLIANNGIAAVKEIRSVRKWAYETFGDEKIVQFVAMATPEDLEANAEYIRMADQYVEVP
GGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLARSKRKILFIGPPGNAM
RSLGDKISSTIVAQHAKVPCIPWSGTGVDTVHIDEKNGLVSVDDDIYQKGCCSSPEDGLE
KAKKIGFPVMIKASEGGGGKGIRQVTREEDFINLYHQAANEIPGSPIFIMKLAGKARHLE
VQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAGPETFGEMEKAAVRLGKLVGYVS
AGTVEYLYSHDDNKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHRISDIRI
FYGLNPRGSSEIDFEFKSEDSLKTQRKPIPKGHCTACRITSEDPNDGFKPSGGTLNELNF
RSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTV
EYLIKLLETEDFEENTITTGWLDDLISTKMTAKKPDPILAVICGAATKAFIASEAARQDY
INSLTRGQVLSKSQLKTMFPVEFIHEGKRYKFTVAKSADDRYTLFINGSKCEVRVRKLSD
GGLLIALGGKSHTIYWKEEVAATRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFLVENGD
HIAAGQAYAEIEVMKMQMPLLSQENGIVQLLKQPGSTIAAGDIIAILTLDDPSKVKHALP
FEGLLPDLGSPVVEGTKPAYKFKSLVTTLENILKGYDNQVIMNASLQQLIEVLRDPKLPY
SEWKLHISALHSRLPIKLDEQLEQLVERSEKRGAGFPAKQLGRLIETHVNQSSDALIGTV
VEPLVDICNRYGNGLEAHEHSVFVNFLEKYYEVEKLFNGATDREENVILKLRDENADNLD
KVALIVLSHSKVSAKNNLILAILKHYQPLCKIYSNVASIFAGPLQRIVELESKATAKVAL
QAREILIQGALPSVKERTEQVEHILKSAVVKTTYGETNTKRNEPDQLILRDLIDSNYVVF
DVLLQFLNHSDLSVATAAGQVYVRRAYRAYTIGEVKSHELSGRPVIEWKFQLPSAAFSSI
PLVKTKMGMNRAMSVSDLSYVADNESAPLRTGIMVSANHLDDVDEALSEGLEIVPQHGNN
PHSSSGPVPDRSGSSASLSNVANVIVGSTDGFSTEEEILKRLNEILDMNKQLLIDSAIRR
ITFMFGFKDGSYPKYYTFNGPNYSENETIRHIEPALAFQLELGRMSNFNIKPIFTENRNI
HVYEAVSKTSPLDKRFFTRGIIRTGHIRDDISIQEYLTSEANRLMSDILDNLEITDTSNS
DLNHIFINFSAIFDVSPADVEAAFGGFLERFGKRLLRLRVTSAEIRIIIKDTETGAPIPL
RALINNVSGYVVRTELYTEIKNSKGEWVFKSLGKPGSMHLRPIATPYPVKEWLQPKRYKA
HLMGTTYVYDFPELFRQAAVSSWAKFSSKTKFTDDFFIANELIEDENGELTEVEREAGAN
SIGMVAFKITVKTPEYPRGRQFVIVANDITFKIGSFGPQEDEFFDKVTNYARKRGIPRIY
LAANSGARIGIAEELVPLFQVSWNDKSDPTKGFEYMYLDNEGLETLKKYKKEHSVITERI
VEHGEERHVIKTIIGADEGLGVECLKGSGLIAGSTSRAYQDIFTITLVTCRSVGIGAYLV
RLGQRAIQVEGQPIILTGAPAINKVLGREVYTSNLQLGGTQIMYNNGVSHLTAADDLAGV
EQIMQWLSYIPAKRDMPVPILETEDKWDRDVEYYPPKDSQFDVRWMLSGKQTPEGFEHGL
FDKNSFFETLSGWSQGVVIGRARLGGIPLGVIAVETRTVETLIPADPANPQSTETLIQQA
GQVWYPNSAFKTAQAINDFNHGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVD
YKQPIIVYIPPLGELRGGSWVVVDPMINAEQMEMYADVDSRAGVLEPAGMVGIKYRREKL
LNTMARLDEKYKTLKEKLSEKGLSAEEHQKASVELAQREKELLPIYHQITLQFADLHDRS
GRMLEKGTIRKEIEWINSRKFFFWRLRRRLNEEYLIKRLNQELPNASRLEKFARIRSWYP
VSMDVDNDRDVATWIEENYQSIDENLKKLKSERFALDVAKSIRNDHDNAITGLCEILKMM
TAEDKEKVLKSLK
NT seq 6702 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgagagtttgtacgaggattctgcccagaaggagcaatacgaggttaccgat
tactcttccagacaccaagtgttgccctcgcatttcgttgggctgaacactgtggagaaa
gtggaggattccccgctgaaggagtttgtgaaggcgcatggtggtcacacagtgatatcg
aaggtgctgatagcgaacaacggtattgccgcagtcaaggagataaggtctgtacggaag
tgggcctacgagaccttcggcgatgagaagatagtgcagtttgtcgcgatggcgacgccg
gaagacctggaggccaatgctgagtacatccgcatggccgaccaatacgtcgaagtacca
ggcggcaccaacaacaacaactacgcgaacgtggacctgatcgttgacatcgccgagagg
gccgatgtcgacgcagtctgggccggctggggtcacgcgtccgaaaacccacttttgcca
gagaaactggctagatcgaagaggaaaatcttgtttataggtccaccaggtaacgccatg
agatcgcttggtgataaaatctcttctacaatcgtggcccaacacgctaaagtgccttgt
atcccatggtcaggtactggtgtggacactgtgcacatagatgaaaagaatgggcttgta
tctgtcgatgacgatatataccagaagggttgttgctcttccccagaggacgggttggag
aaagccaagaaaatcggattcccagtcatgatcaaggcttccgaaggtggtggtggtaaa
ggtattagacaggtcactagagaagaggacttcattaacttataccatcaggcagcaaac
gaaattccaggttccccgatctttattatgaagctggcaggcaaagctcgtcacttagaa
gttcaattgctagccgatcaatatggtacaaacatctcgcttttcggtcgtgactgttct
gttcaaagacgtcaccaaaagattatagaagaagcacctgtcactattgcaggcccagaa
acatttggcgaaatggaaaaggctgcggtacgtctaggtaagttggtcggctatgtctca
gcaggtacagtggaatacctatattcccacgacgacaacaagttctatttcttggaattg
aacccaagattgcaagtcgagcatccaaccactgaaatggtcacaggtgtcaacttgcca
gctgcgcaattgcaaattgcaatgggtatccctatgcacagaattagtgacatcagaata
ttctacggcctaaacccaagaggttcttcagagattgacttcgaatttaagtccgaggat
tccttgaagacccaaagaaagcctatccctaagggtcactgtacagcttgccgtatcact
tctgaagatccaaacgacggtttcaaaccatctggtggtactttgaatgagttaaacttc
agatcgtcgtcgaatgtctggggttatttctccgttggtaacaatggtggtattcactcc
ttctcagactcccaatttggtcacatcttcgcatttggtgaaaacagacaagcatcaaga
aaacacatggtcgttgccctaaaggaactatctatcaggggtgatttcagaactacagta
gaatacttgattaaacttctagaaaccgaagattttgaagagaacacaataactactgga
tggttagacgatttaatttctacaaagatgactgctaaaaagccagatcctattttagct
gtcatctgtggtgctgctacaaaggctttcattgcatcagaagcagcccgtcaggactac
attaactcattgactagaggccaagttctatcaaagtcacagctaaagacaatgttccca
gtagaattcatacatgagggtaagagatacaaatttacagtcgcaaaatctgccgatgac
cgctacactttgttcattaatggttctaaatgtgaagtcagagttcgcaagctgtctgat
ggtggcttattgattgctctaggcggaaaatcacatactatttattggaaggaagaagtt
gctgcaaccaggctttctgtggattccatgactactttgctagaagttgaaaatgatcct
actcagttgcgtacaccttctccaggtaaactagttaaattcttggtagaaaatggtgat
cacattgctgctggccaagcatacgccgaaatagaagttatgaagatgcaaatgcctttg
ctttcacaagaaaatggtattgtacaacttttgaaacaaccaggttctactattgctgca
ggtgatattattgcaattctaacccttgatgacccatcaaaggttaagcatgctctacca
ttcgagggattgcttcctgatctaggctcaccagtagttgaaggcacaaaacctgcttat
aaattcaaatcattagtgactactcttgaaaatattctaaagggttatgacaatcaagtt
attatgaacgcatctctacagcaattgattgaggttttaagagatcctaaactaccatat
tcagaatggaaattacatatatccgcattgcattctagactgcctattaagttggatgaa
caattagagcaactagtagaaaggtctgaaaagcgtggtgctggattcccagccaaacag
ctaggtagactaattgagactcatgtaaaccaatcttctgatgccttgataggtacagtt
gttgagccattggtagacatttgcaacagatatggtaatggtttagaagcacacgaacat
tcagtgtttgttaacttccttgaaaagtactatgaagttgagaagttatttaatggtgcc
acagaccgtgaagaaaacgtcattttgaagttgagagatgaaaatgccgacaacctggac
aaagtagctttaattgttctttctcactctaaagtttcagctaagaacaatttgattttg
gcaattttgaagcattatcaaccactatgcaaaatatattccaatgttgcctccattttt
gctggtccattacaaagaattgtggaacttgaatcaaaggctactgcaaaggtggcatta
caagctagagaaatattgattcaaggtgctttaccttctgtaaaggaaaggactgaacaa
gtcgagcacattttgaagtctgctgtggtaaagacaacctacggtgaaacgaatactaag
cgtaacgaaccagatcaattgattctaagagatttaattgattctaattacgttgtattt
gatgttctattgcaattcttgaatcactcagatttaagtgttgcaactgcagcaggtcaa
gtctacgtccgccgtgcttacagagcctacactattggtgaagttaagtctcatgaacta
tctggcagacctgttattgagtggaaatttcaacttccatctgcagctttctcatcaatt
cctttggttaagactaagatgggaatgaacagagccatgtctgtttctgatttgtcttac
gtagctgataatgaaagtgcacctttgagaaccggtatcatggtttctgccaatcattta
gatgatgtcgacgaagccttatctgaaggtctagaaattgtaccacaacatggtaacaac
cctcattctagcagcggccctgttcctgacagatctggtagctctgcttcgttgagtaac
gtagcaaatgtgatcgttggctctactgatggtttttcgactgaagaagagattttgaag
agactaaatgagatcctggacatgaacaagcaattgctgatcgattcagcaattcgtcgt
atcacattcatgtttggcttcaaagatggttcatatccaaagtactatactttcaatggt
cctaactacagtgaaaacgaaactattcgtcacattgagccagccttggccttccaattg
gaactggggagaatgtcaaacttcaatatcaaaccaatctttaccgaaaacagaaatatt
catgtctatgaagctgttagtaagacttctccattggataagagattctttacaagaggt
attatcagaacaggtcatatcagagacgacatatccattcaagagtatttgacttcagaa
gctaatagattgatgagtgatattttggacaacttggaaatcacagatacttcaaactca
gacttgaatcatatatttatcaacttctctgctatatttgacgtttctccagcagatgtt
gaagctgcttttggtggattcttggaaaggtttggtaagagattactgagacttcgtgtt
acatctgccgaaattagaatcataatcaaggatacagagactggtgcaccaattccattg
agagcactaatcaataacgtttctggatatgttgtcagaaccgaattgtataccgaaatc
aagaattccaagggtgaatgggttttcaaatctttaggtaaaccaggtagtatgcatcta
agacctattgctaccccatacccagttaaagaatggttacaacctaaacgttacaaggca
catctgatgggaacaacctatgtatatgacttcccagaattgttccgtcaagctgcagtc
tcttcatgggccaagttctcttccaagactaaattcactgatgatttctttatcgccaat
gaattgattgaggatgaaaatggtgaactaaccgaagttgaaagagaagcaggtgccaac
tcaattggtatggttgcattcaaaattactgtgaaaactccagaatatcctcgtggtaga
cagtttgttattgtagcaaacgatatcactttcaagattggttcttttggcccacaggaa
gacgaattcttcgataaggttacaaactatgccagaaagagaggcattccaagaatttac
ttggctgccaactctggtgcaagaatcggtatcgccgaagaattggttcctttgttccaa
gtttcttggaatgacaagtctgacccaactaagggttttgagtacatgtatctagacaac
gaaggattggagaccttgaagaaatacaaaaaggaacactctgtcattacagaacgtatc
gtcgaacatggtgaagaaagacatgttatcaagactattattggtgccgatgaaggtctt
ggtgttgaatgtctgaagggttccggtttgatcgctggttctacatctagagcataccaa
gatattttcaccattactttggtcacttgtagatctgttggtattggtgcttatctagtt
agacttggtcaaagagctattcaagttgagggccagccaattattttgactggtgctcct
gctattaacaaagtgttaggtagagaagtttacacttccaacttacaattaggtggtact
caaattatgtataacaacggtgtttcccacttgactgctgctgatgatcttgctggtgtt
gaacagatcatgcaatggctgtcatacattccagctaagagagacatgcctgttccaatt
ttggagaccgaagataagtgggatagagacgttgaatactacccaccaaaggactctcag
tttgatgtcagatggatgctatctggtaagcaaaccccagaaggtttcgaacacggtctg
tttgacaagaactctttcttcgagacgctatcgggatggtcccaaggtgttgtcataggt
agagctcgtttgggaggtattccacttggtgtgatcgctgttgagacacgtactgtcgag
acactgatcccagcagacccagctaacccacaatctacagagacattgattcaacaggct
ggtcaagtttggtatccaaactctgccttcaagactgctcaagccatcaacgacttcaac
catggtgagcaattaccactgatgattctagctaactggagaggtttctctggtggtcaa
agggatatgtacaacgaagtcttgaagtacggttccttcattgtcgatgcgctagttgac
tacaagcaaccaattatcgtctacattccaccactcggagaattgagaggtggttcctgg
gttgtcgttgatccgatgatcaacgctgaacagatggagatgtacgctgatgtcgactct
cgtgctggtgtgctggagcctgctggtatggttggtatcaagtaccgtagagagaaactg
ttgaacaccatggctagactggacgagaagtacaagactttgaaggagaagttgagtgag
aagggtctatctgccgaggagcaccagaaggccagcgttgagcttgcccaacgtgagaaa
gagttgctacctatctaccaccagatcacattgcagtttgctgacttgcacgataggtct
ggccgtatgttggagaagggcaccattagaaaggagatcgaatggatcaactcacgtaag
ttcttcttctggagattgagacgccgtttgaacgaggagtacttgatcaagagattgaac
caggaactgccaaacgcatcacgtttggagaagtttgcacgtatcagatcatggtaccct
gtctctatggatgttgacaacgaccgcgacgtagctacgtggattgaggagaactaccaa
agcatcgacgagaacctcaagaagctgaagtccgagaggttcgcactagatgttgccaag
agtatcagaaacgaccacgataatgccatcaccggtctctgtgaaattctaaagatgatg
accgcagaagacaaggagaaggtcctaaagagcttgaaatag

DBGET integrated database retrieval system