KEGG   Candida glabrata: CAGL0L11000gHelp
Entry
CAGL0L11000g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cgr  Candida glabrata
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CAGL0L11000g
Enzymes [BR:cgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CAGL0L11000g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:1176224..1177060
Genome map
AA seq 278 aa AA seqDB search
MIFTKPMGHDSRLHRVLLLKNMVDGGNDPYTKKIQEHQDSFEEPIFLPLITHTNVPQNII
SRFADRADNLQDDYDFLIITSQRSIECLNLPELKHIRNKLIDKPTYTVGPATSNFLSSLG
FTDIRGGIHAGNGMKLASIIDNDYPAGGKALFLVGEIRKDIIPKYLRPRNFTVDEIIMYK
TAELSDSIVWFKSYLDKCDWIVVFSPQGMSDILQYMKQYSKGARPFKIACIGPTTCEFLN
SNGIEPDLVSPKPDANSLIAAIKEYEVISRLSHSNGDY
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatttttacaaaaccgatgggtcatgattccaggcttcatagggttctgctgctaaag
aacatggtagatggtgggaatgacccatacactaaaaagatacaagagcatcaagacagc
ttcgaagaaccgatcttcttaccactgataactcataccaatgtccctcagaacataata
tcgagatttgcagatagagcagataacttacaggatgactatgattttctaatcatcaca
tctcaaaggtcaatagaatgtttaaatctcccggaattgaagcatattagaaacaaactt
attgataaaccaacttataccgtgggaccagcaacttccaatttcttatctagtcttggt
ttcacggacattagaggtggtatacacgccggaaacggcatgaaactagcttcgataatt
gataatgattacccagctggtggtaaagctttatttttagttggtgaaatacggaaggac
attattcccaagtacctgagacctcggaacttcacagttgatgaaatcataatgtataag
actgcagaactgtcggattccattgtttggttcaagtcttacctagacaaatgtgattgg
atagtggtattctcacctcaaggaatgtcggacatccttcagtatatgaagcaatatagt
aaaggtgccagaccatttaaaattgcatgtattgggcctacgacttgcgaattcttgaat
tcaaatggcattgaacctgatctggtcagtcccaaaccggatgctaactccttaatagct
gctataaaggaatacgaagtaattagtcgtttatcacatagcaatggcgattattga

DBGET integrated database retrieval system