KEGG   Candida glabrata: CAGL0L11044gHelp
Entry
CAGL0L11044g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cgr  Candida glabrata
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CAGL0L11044g
   00670 One carbon pool by folate
    CAGL0L11044g
Enzymes [BR:cgr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CAGL0L11044g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:complement(1178883..1179725)
Genome map
AA seq 280 aa AA seqDB search
MSKKILMLHGFVQSDRIFSAKTGGLRKALKKMGYELDYPCAPILVDKSSLMSSSSQKEVE
ASVAKQFNTDLGVGKDGSENQLYGWWQRKAGGDFYSYEIPQNTLDFLRQYIVENGPYDGV
IGFSQGGGMGAYLVSDLNNLLNLSKEQQPDLKFFVAFSAFRLEPEQYAQHFKTHPISVPT
LVIQGELDTVVSETRVMSLYDAILPQYRALLKHHGGHFIPNQKPFLNQVCGWIQSVTTNP
SNDEDMDIDMNSIKSSAKSSSTQLQMDDDLLDMIDSMGKL
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaagatacttatgctacatggctttgtccagagcgatcgaatattctctgcc
aaaactggtggcttgcgtaaagctttaaagaagatggggtatgagcttgattatccatgt
gcgcctatactagtggataaaagctctttgatgagctctagctctcaaaaggaagtggaa
gcttccgttgcaaaacaattcaatactgacttgggggtaggaaaggatggttcagagaat
caactgtatggttggtggcaaaggaaagcaggtggtgacttctactcctatgagattcca
caaaatacacttgattttctgagacaatatatcgttgagaatggaccctatgacggtgtc
attggttttagccaaggtggtggtatgggtgcttaccttgtgtcagacctgaacaatctg
ctaaacttgagcaaagagcaacagcctgaccttaaattctttgtggcattcagcgcattt
agactagaacctgaacagtatgcacaacacttcaagacccacccaataagtgttccaaca
ttggtgattcaaggcgaattggatacagtagtctcagaaaccagagtaatgagtctatat
gatgccatcctccctcaatatagagctcttctgaaacaccatggcggccattttatcccc
aaccagaagccctttttaaaccaggtttgcggctggattcaatcagtcactacaaatcca
tcaaatgatgaggacatggatatcgacatgaacagtatcaagagcagtgctaagagtagt
agcactcaactacaaatggatgacgacctactagacatgattgactccatgggcaaacta
taa

DBGET integrated database retrieval system