KEGG   Candida glabrata: CAGL0L11154gHelp
Entry
CAGL0L11154g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
cgr  Candida glabrata
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cgr00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
L:1187054..1192240
Genome map
AA seq 1728 aa AA seqDB search
MDSSSIAHESDIVSTERNILPERFISNKQQGNYLEDGSGDGNGKAAEHWLLAAIFNFFWV
ISYFISGSTHIAFRSSWYIVSLLLLKFPKWIIVEANHIHLTIPFSVLVVTLAIIFYVSYE
FLKGRLLSEYKNLTSDLNTDSLNSKNSKSSRLLHHDSKDSNTTRRRRYSSGKLLSSALHE
SHSGINGGDDGDDTFLSSYLDQFLSAIRIFGYLEKPVFHDLTKNMKTQKLDEGEILLLDN
SVGFAIVVEGTLDIYHEVEEKGNMNDIDGDFMVDDNQSIYSILKRKKKKYSTSRHGQYNN
NSDPGHYNGHNVNGDDEDDDDGILQMRSSSRNQNIPSFDAIESSSSDEESDINDGDSESQ
SESDDESTGFIRLKDGLGKFQLLNTVKAGNPVSSLVNILNLFTSANDNVTSPSRTGRMDS
NYTNPVERPTSKLSTSIEESAMRLELGKYSLSPTEASYRSTSNPSNNFSKDNDPLSKSIS
GPDAVTTPSLPPLNNRAFVIPKVVARAATDCTIAIIPPQAFAKLKAKYPRSASHIIQMIL
TKLYHVTFQTAHKYLGLTQEIAYTELLLNRTVSYDLPNYLKEIVIDRFKDKGKDMNLQKG
FQSPTSSRLTSNFNGNSNNQRTNSRNSQALMSTRDLRKTRPELSQQSSMIHSPTPITGSR
HVVLESRDKYNPGDLLSNVPLSRINLASPSSRGFDYSSMKKESSPQSSVNSRKRSTTGER
PRLLKRPSIYNNQSSSRSDALKGNNSNNKDINFTSFSAQEETEDSVVRMALVEAMLTYLG
VNKTNMSILPGIYDGAPSEPHSHRASEISLVSSYTSSAAPQTTIRILPKEYAIVSTRKQK
QSSKKRRKYKEEISPTLDYEYAKNEFAQAIELQYFKQGTVIVEQDTRGKGLYYVVSGKID
VTTSTVSDHEIFNSTRDKKKKKSKTLFTIESGGIAGYLSSLVSYKSFVTLIAKTDVYVGF
LPYQTLEKLCDKYFLIYLRIAESLTSLLTPRMLKLDHALEWLHLNASDTLFNQGDPANGI
YVILNGRLRQLRNPELEENSTDYPNDGEEKDSSRDSTIVMGELGQGESFGEVEVLTAMDR
ISSMVAVRDTELARIPRSLFELLAIEHPSIMIRVSRLVAKKILGQGQANMALPKIGSGSN
LRHDLNLTIPPSSSSSIHTHSYGNDNSNQMNNANFRTITILPITSGLPVESFAMKLVHAF
KQVGRTTIGLNQRTTLSHLGRHAFDKLAKLKESGYFAELEELYQTVVYIADTPVKSSWTK
TCIAQADCVILLARADDSPEIGEYERLLLKSKTTSRTELVLLHNERSVEPGMTQRWLRSR
SWVHNHYHIQFAMDSLVNSSNVKDTGGNIGALNLVDKFIQTELGRKTQYNISKLLPESIK
MTVENFSSRFMKRKRQYYTPVHRHKDDFLRLARILSGQAIGLVLGGGGARGLSHLGILQA
LEERGIPIDMIGGTSIGSFVGGLYAKDYDLVPIFGRIKKFAGRISSIWRMLSDFTWPVTS
YTTGHEFNRGIWKSFGDTRIEDFWVQYFCNSTNITESVQEIHSYGYAWRYVRASMSLAGL
LPPIEDNGSMLLDGGYVDNLPVLEMKARGCNTIFAVDVGSVDDRTPMKYGDSLNGFWIIL
NRWNPFSKHPNIPTMAEIQVRLGYVSSVNALEKAKRTPGVIYVRPPIENYATLDFGKFEE
IYKVGADFGKVFLQALAEEGKMPYIPGSNADLVGDVETGFFLHRRNSI
NT seq 5187 nt NT seq  +upstreamnt  +downstreamnt
atggattcgtcctcgatagcacatgagtctgatatcgtatcgacagaaaggaatatctta
cctgaaaggtttatatctaataagcaacaaggaaattacttagaggacggtagtggtgat
ggtaacgggaaagctgctgagcactggttgttagctgccatattcaacttcttttgggta
atatcgtactttataagtggttctactcatattgctttccggagctcgtggtatatcgtg
tcactattgcttttgaagttccctaaatggattattgtcgaagcaaatcacatccatttg
accattcctttcagtgttctcgtggtgacccttgcgattatcttttacgtgagttacgag
tttttgaaaggaagattgttgtccgaatataaaaacttgacttcagacttaaacactgac
tcccttaacagcaaaaactcaaaatcatccagattattacaccatgatagtaaggatagc
aatacaactagaagaagacgttattcctctgggaaattgttgtcatctgctttgcatgaa
tctcactcgggaataaatgggggtgacgacggtgatgatactttcttgtcttcttacttg
gaccaattcctaagtgctattagaatatttggttatttggaaaaacctgtcttccacgat
ttgaccaaaaatatgaagactcaaaaattggatgaaggtgaaatattactgttagataac
tctgttggctttgcaattgtggtggaaggaacgcttgatatttatcatgaagtggaagaa
aaaggtaatatgaacgacatcgatggagatttcatggtcgatgataaccagtcgatttat
tctatactaaagagaaagaagaagaaatactcaacctccagacatggtcaatataataat
aattctgacccaggtcactacaatggtcataatgttaacggtgacgatgaagacgacgat
gatggcattttacaaatgaggagtagttctcgtaatcaaaacattccttcatttgatgcc
attgagtcatcttcatccgatgaagaaagtgatatcaatgacggagactcggagtctcaa
tccgaatccgatgatgagtctacgggtttcattagacttaaagacggcttgggtaaattt
cagcttttaaatacagtgaaagctggtaacccagtatcttccttagtaaatatcttgaat
cttttcacttctgctaatgacaacgtaacttctccgtcaaggacaggtagaatggatagt
aattacactaatccagttgagagacctacttcgaaactatcgacgtctatcgaagagagt
gcaatgagacttgagttgggcaaatatagtttatccccaacagaagcttcatatcgaagc
accagtaacccttccaataatttcagtaaagacaatgatccattgtctaaatccatatcg
ggcccagatgcggtaaccacaccatctttaccacctttgaataatagagcattcgtaata
ccaaaagttgtagccagagctgcaactgattgtactattgcaatcatacctccacaggca
tttgctaaattgaaggcaaaatatcctcgctcggcatctcatatcatacagatgattctt
acaaaattataccatgttacattccaaactgcccacaaatacttgggactaacacaggaa
attgcatacaccgagttgttacttaatagaacggtgtcatatgatctaccaaactatctc
aaagaaattgtaatagacaggttcaaggacaaagggaaagatatgaatttacagaaaggg
tttcaaagccccacgtctagccgattgacttcgaacttcaacggtaactcaaataatcaa
cgtaccaatagtagaaactcccaagcattaatgagtactagagatttacggaaaactaga
cctgaactcagtcaacaaagttcgatgattcattctcctacgcctataactggttctagg
catgtggtattggaatcccgtgataaatataatcctggtgatttattgtcaaacgtccca
ctatccagaataaaccttgcttctccaagttcaagaggatttgactatagctcaatgaag
aaagaaagctcaccacaatcatctgtgaatagtaggaaaagaagtacaactggtgaaagg
ccaaggttattgaaacggccatcgatatataacaatcaatcgtcaagtcgctccgatgcc
ttgaagggaaataatagtaataataaagatattaactttacttcattttcggcacaagaa
gaaacagaagactcagtggtacggatggcattggttgaagccatgctaacatatttgggt
gtgaacaagacaaatatgtctatattgcctggtatctacgatggtgcgccctcggaacct
cattcgcatagggcttctgagatatccttggtttcttcatacacatcatcagctgctcca
caaacaacaatcagaattttgccaaaggagtatgcaattgtatctaccagaaagcagaaa
caaagctccaaaaaaaggagaaaatataaagaagaaatttcaccaaccttggattatgaa
tatgctaagaatgaatttgcacaagcaattgaacttcagtattttaaacaaggcacagtg
attgtcgagcaagataccagaggtaaaggtctctactacgtagtgtctggtaaaatcgac
gtgacgacttcaacagtcagtgatcatgaaatattcaacagtaccagggataagaaaaag
aaaaaatcaaagactttatttacaattgaatcaggaggtatagctggttatttgtcatca
ttggttagctacaaatcgtttgttactttgattgccaagacagatgtttacgtcgggttc
ttaccttatcaaactttagaaaaactgtgtgacaaatattttttaatctacttgagaatc
gccgaaagtttgacaagtctattaacacctcgtatgttgaagttagatcatgcattagaa
tggctacacctaaatgcatctgatacattgtttaaccagggtgatcctgctaatggtata
tatgttatattaaatggtagattgcgtcaactcagaaatcctgaattagaagaaaatagc
actgattatccaaatgatggtgaagagaaagactctagcagggacagtacaattgttatg
ggtgaattgggtcaaggagaaagttttggtgaagtcgaagtgttaactgccatggataga
ataagctcaatggtggccgtgagagatactgagcttgcaagaataccgagatcacttttc
gaattattggccattgaacacccctcgattatgattagggtgtcaagattggtggctaag
aaaatattaggtcaaggtcaagcaaatatggctttacctaagataggctcaggttcaaac
ttaaggcatgacttgaatttgactattccaccttcaagtagctcatcgattcatactcac
tcatatgggaatgataacagtaatcaaatgaataatgcaaattttagaacgattacgatt
ttgcccattacaagcggactcccagttgagtcatttgcaatgaaattagtacatgctttc
aaacaggtgggaaggacaaccattggattgaaccaaagaacgaccttaagtcatttaggt
agacatgcctttgataaacttgcaaaactgaaagaaagtggttatttcgctgaactagaa
gaattatatcaaacagttgtctacatcgccgacacaccagttaaatcttcttggacaaaa
acatgtattgctcaggcagattgtgttattctattggcaagagccgatgacagtccagag
ataggtgagtatgaaaggttgctactgaaatccaaaacaacatcaagaacagagctggtg
ttgttacataatgaaagatctgttgaaccaggaatgacccaaaggtggctacgtagtaga
tcgtgggttcataatcattatcatatccaatttgcaatggattccttggtaaactcatct
aatgtaaaggatactggtggaaatataggtgctttaaacttggtggataaatttattcaa
acggagttaggtaggaaaacacaatacaatatctcaaagcttctaccagaatctattaaa
atgactgttgagaatttctcttcaagattcatgaaacggaagcgccaatactatacacca
gttcatagacacaaggacgacttcctgagattggccagaatcttgtcaggtcaagctatt
ggtcttgttttaggtggtggtggtgcaagaggtttgagtcatcttggtattttacaggca
ttagaagaacgtggtattccaattgatatgattggtggtacatctatcggatcatttgtt
ggtggactttacgcaaaggattatgacttagtcccaatattcggtagaattaagaaattt
gctggtagaatttcctcgatttggagaatgcttagtgactttacctggcctgtgacttcc
tatactacaggtcatgaattcaatcgtggtatatggaagagttttggagataccagaata
gaagacttttgggttcaatacttctgtaactcgactaatattacagaatctgttcaagaa
atacactcatacgggtatgcctggcggtacgttagagcttcgatgtcattggcaggtctg
ttacctccaatagaagataacggctctatgttactggatggtggctatgttgataacctt
ccagtgctggagatgaaggctagaggatgcaatacaatatttgctgtagatgttggatct
gttgatgatagaacaccaatgaaatatggtgattctttgaatggtttctggattatacta
aatagatggaatcctttttctaagcatccaaatatacctacgatggccgaaattcaggtt
agacttgggtatgtgtcgtccgttaatgccttagagaaggcaaaaagaactcctggtgtc
atctatgttcgtcctccgatagaaaattacgctacattggattttggtaaatttgaagaa
atttataaagtcggtgcagattttggtaaagttttcttacaagcactggctgaagaaggt
aagatgccttatattcctggttccaacgcagatttagttggggatgtggaaactggattc
tttttgcatagacgtaacagtatttga

DBGET integrated database retrieval system