KEGG   Candida glabrata: CAGL0M01958gHelp
Entry
CAGL0M01958g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
cgr  Candida glabrata
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CAGL0M01958g
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     CAGL0M01958g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
M:complement(238113..240875)
Genome map
AA seq 920 aa AA seqDB search
MQLPRYENKPFKPPRRIIPSGTVPRPVRSVGGSTASTFGVKRTYAQTAELQPARSNDTSD
RSKTDTTRRYFTIMYRKYTTKKNKTWNGDGYAILILDAAIKLIIYNEQGKPLGSSTKVNI
DTLFDSIYTTKGLEFQLDYEIFDTDEIRKVRILLGKEPDSNLIPSQTSSSQQNAIDKGIS
SELPVSQLFTKSTKKFISPTLKTNPNARPISSMNKQIAKTNRPENTVPTQKFRSLFDCNT
IENPLIMNTFQGSEVDIIVDPLLCKMLRNHQRIGVKFMYDCLLGLETNLTAESTDDKSCR
LERDSDIKGCILADDMGLGKTLMTITLIWTLLKQTPFASKVQCSQLGVPLSGMISKVVIV
CPVTLIGNWKREFKKWLGLNRIGILTLNPKNNVDMDKISVRNFIKVNRTYQVLILGYEKV
LTVQEELLKQKDKLDLLICDEGHRLKNGASKILKVLKSLDIDKKVILTGTPIQNDLNEFF
TIIDFVNPGVLGTYASFKKLYINPISRARDINNKFNTKVIEQGEEKSNQLIEFTKRFILR
RSNNILSKFLPPKTDIILFCRPTIEQIKAFRDIIENVRVDMNNITFNTSLGLINLMKKVC
NSPSLLCNDPYYQSNVDSNIFTVSNKSNSSGKLTVLLELLLEIKATSPMEKVVIVSNYTQ
SLDIIQGLMNSNQLSNCRLDGATPAKQRDMLVNTFNNNPNIFGFLLSAKAGGVGLNLIGA
SRLVLFDNDWNPAVDLQAMSRIHREGQKRPCYIYRLITTGCIDEKILQRQLMKHNLTRKF
LSSNTSDTGSANDDLFDKSDLKDLFTIHQNTKSNTHDLICRCDGLGEEFDDDEEVLKAPA
LDGSFEQWSNALDAKRKMDVLESQRTQLEKKLLKQCLLDYKHIDPDRSLDLYDDVATEVY
KKGKKNITFAFIKVGNVIIE
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgccacggtatgagaacaaaccattcaagccaccaagaaggataataccttct
ggaactgttcctcgaccagttcgctctgtgggcggttccacagcatcgacttttggtgta
aagagaacatatgctcaaactgctgaattgcagcctgctagatcgaatgacaccagtgat
aggagcaaaactgatacaactaggagatattttaccatcatgtaccgaaaatacacaacc
aagaagaataaaacatggaacggagatggatatgctattctgatacttgatgctgctatt
aaattgataatctacaatgagcaagggaagcctctcggctcaagtactaaagttaacatt
gatacgcttttcgattccatttataccacaaaaggtcttgagttccagttggattatgaa
atatttgatactgatgaaatcagaaaggttagaatattactagggaaagaacctgactct
aatttgataccttctcaaacttctagtagccagcaaaatgcaatagataagggcatctcc
tcagaattaccagtatcgcaactttttactaagtctactaagaaattcatctctccaaca
ctaaaaactaaccctaatgctagacctatctcatcaatgaataagcaaatagcgaaaaca
aatagaccagaaaatactgttcctacacaaaagttcagaagcttatttgattgcaataca
attgagaatccacttattatgaatacgtttcagggttctgaagtcgacattatagtggat
ccccttttatgcaaaatgcttcggaaccaccagagaattggagtcaaatttatgtatgat
tgtttattgggattggaaaccaacctgactgctgagtctactgatgacaaatcttgccgg
cttgagagagactcagatattaaaggttgcattttagccgatgatatgggacttggtaaa
actctaatgacaatcacattgatatggacattactaaaacaaacaccctttgcatcaaaa
gtgcagtgttcacaacttggtgtacctctgagtgggatgataagcaaagtagtcattgta
tgtcctgttactttaattggcaattggaaacgagaatttaaaaaatggttgggactaaac
agaattggaattttaactcttaaccccaaaaacaatgtggacatggataaaataagtgtg
agaaacttcataaaagttaatagaacttaccaggtactaattttaggttatgaaaaagta
ttgacagtccaagaagaacttcttaaacaaaaagataaactagacttacttatatgcgat
gaaggtcatcgcctaaaaaatggagcatcgaaaattcttaaagtattgaaatctttagat
atcgacaagaaagtgattttgacggggacaccgatacagaatgacctgaatgagttcttt
acgatcatcgattttgtgaatcctggagttttaggaacttacgcaagcttcaaaaagttg
tatatcaatcctatatcaagggcgagagatattaataacaaattcaatacaaaagtaatt
gaacaaggtgaagagaaatctaatcaacttatagaatttaccaagagatttattcttaga
cggtcaaacaatatcctatcaaaatttctgcctcccaaaacagatattattttattctgt
agacctaccattgaacagatcaaagccttcagagacattatcgaaaatgtaagggttgat
atgaataacatcacatttaatacttcccttgggctgatcaatttgatgaaaaaggtttgt
aactctccatcgttgttatgtaatgacccttactatcaatctaatgtggatagcaatata
ttcacagtttccaataaatctaacagctccggtaaattaactgtgcttctggaattactg
ctagaaatcaaagctacttctcctatggagaaagttgttatagtatcaaattacacacag
tcattggatattatacaaggactcatgaacagtaaccagttatccaattgcagattagac
ggagcaacgccagctaagcaacgtgatatgttggtcaacacatttaataataaccccaac
atttttggtttcttattaagtgctaaggcaggtggtgttggattaaatttgattggtgcc
tctcgcttggttttgttcgataatgactggaatccagctgttgacttacaagcaatgtct
cgtattcacagagaaggtcagaaaagaccatgctacatttacagactaataacaactggc
tgtatagatgaaaagatattacaaaggcagctcatgaagcataatttaaccaggaaattc
ttatcctcaaataccagcgataccggctcagcaaatgatgatctattcgacaaatcagac
ttgaaagatttgttcacaattcatcaaaatactaagagtaatacacacgacctgatatgt
agatgcgatggattgggtgaggagtttgatgacgatgaagaggtattaaaggcacctgca
ttggacggaagttttgaacaatggtccaatgcactcgatgctaaaagaaaaatggatgta
ttagagtcacaaagaacacaacttgaaaagaaacttctaaagcaatgccttctcgattat
aaacatatagatcctgatcgatccttagacctctacgatgatgttgctacagaggtatac
aaaaaagggaaaaagaatataacgtttgctttcatcaaggttggaaatgtgataatagaa
tga

DBGET integrated database retrieval system