KEGG   Candida glabrata: CAGL0M03993gHelp
Entry
CAGL0M03993g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
cgr  Candida glabrata
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CAGL0M03993g
   03420 Nucleotide excision repair
    CAGL0M03993g
   03430 Mismatch repair
    CAGL0M03993g
   03440 Homologous recombination
    CAGL0M03993g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
M:complement(445590..446429)
Genome map
AA seq 279 aa AA seqDB search
MATYQPYNEFSSVTGGGFENSDSRPNTMDSGTGSNTNTLTPVTIKQILDSQQAIQDGPFI
THNQELHHVCFVGVVRNITDHTSNIYLTLEDGTGQIEVRKWSDDSSDVAQGTDGDDGFGE
MKGGESQIAQQYQIGTYVKVFGALKEFGGKKNIQYAVIKNVDSFNDVIAHHLEAIKCHAI
ANGKMQGSSLASGDNEGAGQSLFVQDDEGAGNKNPLQRILEFCKQQCVGKDANTFAVPIP
LISQSLDIDETTVRNCCTTLTEQGFIYPTLDDNHFFAVD
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggcgacttatcaaccttacaatgaattctcatcggttaccggtggagggtttgagaac
tctgattcgaggcctaacactatggactctggtactggttccaacaccaacacgctaact
cccgttactatcaagcagatattggattcacaacaggccatccaggatgggccctttata
acacataaccaagaattacaccatgtgtgtttcgttggtgtggtgaggaatattactgac
cacacgtctaatatatatctgacattagaagatggtacggggcagattgaagtaagaaaa
tggagtgacgatagctctgatgttgctcagggaacggacggtgatgatggttttggggaa
atgaaaggcggtgaatcacaaattgcacagcaatatcagataggaacttatgttaaagta
tttggtgctttgaaagaatttggtgggaagaaaaacatccagtatgctgtcatcaagaat
gtagactcattcaacgacgtaattgcccatcatctagaggctattaaatgccatgccata
gcgaacggtaaaatgcaaggcagttctttggcttctggagacaacgaaggtgcaggacaa
tccttgtttgttcaagatgacgaaggagctggtaacaaaaacccattgcagagaatattg
gaattctgcaagcaacaatgtgttggtaaagacgcaaacacctttgctgtaccaatccct
ttgatttctcaatctttagatatagatgaaacaactgtcagaaattgttgtacaacgcta
acagagcaaggtttcatatatccaacattagatgataatcatttctttgctgtggattag

DBGET integrated database retrieval system