KEGG   Candida glabrata: CAGL0M04367gHelp
Entry
CAGL0M04367g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
cgr  Candida glabrata
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:cgr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CAGL0M04367g
Enzymes [BR:cgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CAGL0M04367g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
M:479260..481074
Genome map
AA seq 604 aa AA seqDB search
MPLSEIEPHSPSAKKASGHRRSRRHSSIGSSSRKPSLTRNRSTLRLMRTISIESLNNDTF
SASGGEDEDNSNSDYNDVSGTNQDLEDKIGNLSIKSGISQSSSDIKTTPAKKGSGGVSAS
STDNSIEVPFVKVALDITLPQDYFKKDVANMIQSLKVPRWYARGLVESPLKMESLRLTKI
AGAMTNAIFKVEYPALPSLLLRVYGSNNDMIIDREYELQVLARLSVQHIGPSLYGCFLNG
RFEQFLENATTLTKDDIRDWKTSQRIARRMKELHTGVPLLRFEKEQGSMAWNKIDQWLKE
IEMNGGDWISNDDNVQQVFGAPNWKEFKESIRKYREWLFENSKSPYVFCHNDAQYGNLLF
SAPVINSEKNDLKKSLDESNLSTSSLFPSDSRVSLKEIINPTKQEQSQDSKLVVIDFEYA
GANVAAYDLSNHFSEWMYDYNSSTPHKCFSDQYPTTEQMLNFVYSYVSHLRGGVKTDIDD
DARLLYNDIKKWRGTVQLFWSLWALIQSGKIQFQEQESTKVDEGLVGEKYIIKTEDTAID
ELVDDIDTNDVIEAPEGVSIDTFDYLGYCTDKISVFWGDIIGFNIITKSECIENKVKYLS
TDLL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgccattaagtgaaatcgagccccatagcccttctgccaagaaggcatctggccaccgc
agatctagaaggcattcgagtatagggtcgtcttctaggaagccttcgttaacaagaaac
agatcaacacttaggttgatgcgtacaattagtattgagtcgttgaacaacgacactttt
tcagctagtgggggtgaggatgaagataattctaactcggattacaatgatgtatcagga
acaaatcaagatctggaagacaagataggtaacttgagcatcaagagcggtatctcccaa
agctcgtcggatattaagactacacctgccaagaagggttctggtggtgtgtcagcatcg
agtactgacaattctatcgaagtcccttttgttaaagtagcattagacattacattgcct
caggactacttcaagaaggatgttgccaatatgattcaaagtctaaaagttccaagatgg
tatgctaggggactcgtcgaatcgcctctgaagatggagtccttgagacttacaaaaatt
gctggagcaatgacaaacgctatctttaaagtcgagtatcccgccctgccttctctatta
ttaagggtttatggttctaacaatgatatgattattgacagagagtacgagttacaggtc
ttggcaaggttatcagttcaacatattggaccctcgttatatggttgttttctaaatggg
cgctttgagcaatttttggaaaacgcaacaacactcacaaaggatgatatcagagattgg
aaaacctctcaaagaatagctagaagaatgaaggaactacacactggtgtgcctttatta
aggtttgaaaaggaacaaggatctatggcgtggaacaaaattgaccaatggttaaaggaa
attgaaatgaatggcggggattggatttcgaacgatgataatgtgcaacaggtgtttgga
gctccaaactggaaagagtttaaagagtccataagaaaatacagggaatggttgtttgaa
aatagtaagagtccatatgtattttgtcataatgatgcacagtatggtaatttattattt
agtgcaccagtgatcaacagcgagaaaaacgatctaaagaaaagtctcgatgaatcaaat
ctatccacatcttcgttgtttccatctgattctagagtatctttgaaggaaatcattaat
ccaacgaaacaagagcagagtcaggactcaaaacttgttgttattgattttgagtatgct
ggtgctaatgttgctgcatatgatctttcaaatcacttttcagaatggatgtatgattat
aatagttccacccctcataagtgtttttcagaccagtatcctactactgagcagatgtta
aattttgtctactcatatgtttcacatctaagaggtggtgttaagactgatatagacgat
gatgcaagattactctacaatgatattaaaaaatggagaggtacagtccaactgttttgg
agtttgtgggcactaattcaaagtgggaagattcaattccaagagcaggaatctactaag
gttgatgaagggttggtaggtgagaaatatataatcaagaccgaagacactgcgatagac
gaattggtagatgacatagatacaaacgatgtaattgaggcacctgaaggtgtaagtatc
gatacttttgactatctgggttattgtactgacaagatttctgtgttctggggagatatt
ataggattcaacatcataacaaaatcagaatgtattgagaataaggtgaaatacctaagc
acagatttattgtga

DBGET integrated database retrieval system