KEGG   Candida glabrata: CAGL0M08404gHelp
Entry
CAGL0M08404g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cgr  Candida glabrata
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:cgr04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
M:complement(836791..838179)
Genome map
AA seq 462 aa AA seqDB search
MQILGENFKEVEIMDSEYDRRKLEEESAGPPGDEPMGQENHEQLENHIDKATESQMSKEL
VVEDDQYDQGSHNIDYEARNKEEHNNGTNRTDGGHTQGTEQSNEQQTESNHEQQQQQRLQ
QTEQHQQHQMETVKKPLIYGANTSGKYTLSDFQILRTLGTGSFGRVHLIRSNHNGRFYAL
KALKKHTVVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQHVFMVMDYIEGGELFSL
LRKSQRFPNPVAKFYAAEVCLALEYLHSKEIIYRDLKPENILLDKNGHIKITDFGFAKYV
PDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYDANTMKTYEHIL
NSELKFPSFFHPDVQDLLSKLITRDLSKRLGNLQNGSEDVKNHPWFSEVVWEKLLARYIE
TPYEPPIQQGQGDTSQFDRYPEEEINYGVQGEDPYADLFREF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactgggagaaaattttaaagaagtcgagattatggatagcgaatacgacaga
aggaaactcgaagaagagagtgcaggacctcctggtgacgaacctatgggtcaagaaaac
catgagcagttagaaaaccacattgataaagctacagagtcccaaatgagtaaagaactt
gtggtggaagacgaccagtacgaccaggggagccacaatatcgactatgaggcaagaaac
aaagaggaacataacaatggtacgaaccggaccgatggtggacatacacaaggtactgaa
caatcaaacgaacaacaaacagaatcaaatcacgaacaacagcaacaacaacgactacag
caaacagagcagcaccaacaacaccaaatggaaacggtgaagaaaccgctcatatatggg
gctaacacttcaggaaagtacaccctatcagacttccaaatattacggactttaggaaca
ggttcctttggtagagttcatttaattcggtcaaatcataatggtagattttacgctttg
aaagcgctaaagaaacacacagttgtaaaattaaaacaagtagagcataccaacgacgaa
agaaggatgttatcgatagtgtcccatcccttcatcattcgtatgtggggtactttccag
gactcacaacatgttttcatggttatggactacatcgagggtggtgagttattctcccta
cttaggaaatcgcaaagatttcccaaccctgtagcgaaattttatgcagccgaagtatgc
ttggcattggaatatttacacagtaaagagataatatacagagatttgaagccagagaac
attctacttgacaaaaatggtcatataaagattaccgatttcggatttgctaaatatgtt
ccggatgttacatacacactatgtggtacaccagattatattgctcctgaagtagtaagc
actaagccttataacaaatctgttgattggtggagtttcggtattttgatatacgaaatg
ttggctgggtatacaccattttatgatgcaaatacaatgaaaacttacgaacacatttta
aactcggaacttaagttcccttctttcttccatccagatgtgcaagatttactgtctaag
ttaatcaccagagacttgagtaaacgtcttggtaacttacaaaacggcagtgaggatgtt
aagaaccatccgtggtttagcgaagttgtctgggagaaactgctggcgagatacatagag
actccatatgaacctcctatccaacagggacaaggtgatacttcccagtttgacaggtac
ccagaagaagaaataaactacggcgtacaaggagaggatccctacgctgatctattcaga
gagttttaa

DBGET integrated database retrieval system