KEGG   Candida glabrata: CAGL0M10219gHelp
Entry
CAGL0M10219g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
cgr  Candida glabrata
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cgr00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
M:complement(1020895..1022088)
Genome map
AA seq 397 aa AA seqDB search
MLKVETKQRPRRASSVGNIDLGDTVPGFATMHESKASKVAAKRRHERLATQRNLKMTTKL
YLKARDYNYHHMWFLPLCILILTYAAYFGISNKRVKGFLHMFVAISYEQESNPQYYGKGI
KDLAFVFFHMIFFTFLREFLMDVIIRRITQWLNITSKYKIKRMMEQMFSIFYYGFSSPFG
VYVMYHSDLWYFRTNTMYNTYPDILIPKLFKAFYLIQAAFWAQQAFVLVLQLEKPRKDHK
ELCFHHVVTLLLIWSSYVFHFHKMGLAVYITMDVSDFFLALSKTLNYIDSPLTEVVFGMF
VLVWIYLRHVINGKILWSVLTEFRTEGPYILNFATQQYKCWISLPIVFVLIFALQVLNIY
WLFLIFKVLYKIVWQGVTEDVRSDEETDSGSDELKKD
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaagtcgaaacaaagcagagacctagacgtgcttcgtctgtgggaaacattgac
ctgggtgacacggtgcccggcttcgctaccatgcatgaatcgaaagcatcgaaagttgct
gcaaagagacgtcatgaaagactagccactcagcgcaatctaaaaatgaccaccaaactc
tatttaaaagctagagattacaattatcatcacatgtggttcctgccgttgtgcatccta
attcttacatatgctgcttattttggaatctccaataagcgcgttaaaggctttcttcat
atgtttgtcgcgatatcatatgagcaagaatctaatcctcaatactatggaaaaggtata
aaggatttggcgtttgttttcttccatatgatatttttcacttttctgcgtgagttctta
atggatgttattatcagaagaataacccaatggctgaacatcacttcaaaatataaaata
aagagaatgatggaacaaatgttctccatcttttactatggtttttcgagtccatttggt
gtctatgtaatgtaccattctgatctgtggtatttcagaaccaatacaatgtacaacact
tacccagatattctaatcccaaagctattcaaggctttctatttgatccaagcagcattc
tgggctcaacaagcatttgtcttggtgctacaattagagaaaccaagaaaagatcacaaa
gagctatgcttccatcacgtagttacacttctattgatatggtcttcttatgtgtttcat
ttccacaagatggggctggcagtttatatcacaatggatgtatctgactttttcttggca
ttatccaagaccttgaactatatcgattccccattaacagaagttgtctttggtatgttt
gttttggtatggatctatttacgtcatgttatcaatggcaaaattttatggtctgtgcta
actgaattcagaaccgaaggcccatacattttgaatttcgctactcaacaatacaaatgc
tggatctcacttccaattgtatttgtgctaatatttgcacttcaagtactaaacatctac
tggctgtttttgatctttaaagttctgtataagattgtttggcaaggtgttactgaagat
gtcagaagtgatgaagaaaccgattctggtagcgatgagctgaaaaaagattga

DBGET integrated database retrieval system