KEGG   Candida glabrata: CAGL0M11198gHelp
Entry
CAGL0M11198g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
cgr  Candida glabrata
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
M:1102767..1104152
Genome map
AA seq 461 aa AA seqDB search
MDDCQHIQSIFENPKNRAAWLNALSTTQSVLRHSPIKAKLLHAFRCSTCKEISNGSNFLC
LQCGFCGCWNGSHFEQHSKETGHLFGINAQTELVFCFQCMDYVGDFDLFRDAALANRWDY
YEEYTNVPTVDQIDGMAGLVNMGSTCYMSSIMQCIIHNPYMIRYFMCQQHSNNCTLKMAS
NCTSCAISSIIADFYGNSVQNDYKSKKNNNNKHEGFINLLTCSWKVNENLAGYSQQDAHE
YWQFILNHIHQDYKSSMHSHSDDKLCNCVVHSSFQGSLKSSIVCPECNNDSKTTFDPFID
LSLGIKDKHTLTECLDNFHKKEQLHDYDFFCKKCQAQQNPIKQFTINKLPPVLVLQLKRF
EHLMSGVNQKLNDYIEFPKILDMKPYLKDNQNPDEDPSILYELIGIISHTGSVNEGHYVA
FCKIENGEWFKFNDSMVTKILEKDVLKEQAYLLFYIVKHIS
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggatgattgccagcatattcagtcaatttttgagaatcccaagaatagagcagcttgg
ctaaatgcattaagtactacacagagtgtactacgccattctcctatcaaggcgaagcta
ttgcatgcttttcgatgctcgacttgcaaagagatatccaatggttcgaactttttatgt
cttcaatgtggattctgcggctgctggaacggctcacattttgaacaacatagcaaagag
acaggtcatttatttggcattaatgcacaaaccgaactagtattttgctttcaatgcatg
gactatgttggtgattttgatctatttagagatgcggcattggctaatagatgggactat
tacgaggaatatacaaatgtgccgacagttgatcagatcgatggtatggctggtttagtt
aacatgggatctacatgttacatgagcagtataatgcaatgcattatccataacccatat
atgatacgatacttcatgtgccagcaacatagcaataattgtaccctcaaaatggctagc
aattgtactagctgcgctatttcatcaataatagctgatttctatggcaattcagttcag
aatgattataagagcaagaagaacaataataataaacatgaaggcttcattaatctactt
acctgttcttggaaagttaacgagaatctggctgggtactctcaacaagatgcgcatgaa
tattggcaatttatattaaaccatatccatcaagattacaaaagtagcatgcactcgcat
tctgatgacaaactatgcaactgtgtggttcattcatcattccaaggatcattgaagagt
tcaattgtttgtccagaatgtaataacgactcgaaaacgacatttgatccttttatagac
ctttcattagggattaaagacaaacacacactaacagagtgcttagataattttcacaag
aaagaacaacttcatgattacgacttcttttgcaagaaatgccaagctcaacagaatcca
ataaaacagtttacaatcaataaacttccgccagttttagtacttcagttaaaacggttt
gagcatctaatgagtggtgtaaatcaaaaattaaatgactatatcgaatttcccaaaatt
ttagatatgaaaccttacctaaaggacaaccagaaccctgatgaagatccatcgatatta
tatgaattaatcgggataatttcacatactggatctgtaaatgagggtcactacgttgct
ttttgtaaaatagaaaatggagaatggttcaaattcaatgattctatggttacaaagatc
ctggaaaaagatgtgctaaaagaacaagcatatttattattttatatcgtaaagcatatc
agttaa

DBGET integrated database retrieval system