KEGG   Candida glabrata: CAGL0M11198gHelp
Entry
CAGL0M11198g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
cgr  Candida glabrata
Brite
Enzymes [BR:cgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CAGL0M11198g
Peptidases [BR:cgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CAGL0M11198g
Transcription machinery [BR:cgr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CAGL0M11198g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
M:1102767..1104152
Genome map
AA seq 461 aa AA seqDB search
MDDCQHIQSIFENPKNRAAWLNALSTTQSVLRHSPIKAKLLHAFRCSTCKEISNGSNFLC
LQCGFCGCWNGSHFEQHSKETGHLFGINAQTELVFCFQCMDYVGDFDLFRDAALANRWDY
YEEYTNVPTVDQIDGMAGLVNMGSTCYMSSIMQCIIHNPYMIRYFMCQQHSNNCTLKMAS
NCTSCAISSIIADFYGNSVQNDYKSKKNNNNKHEGFINLLTCSWKVNENLAGYSQQDAHE
YWQFILNHIHQDYKSSMHSHSDDKLCNCVVHSSFQGSLKSSIVCPECNNDSKTTFDPFID
LSLGIKDKHTLTECLDNFHKKEQLHDYDFFCKKCQAQQNPIKQFTINKLPPVLVLQLKRF
EHLMSGVNQKLNDYIEFPKILDMKPYLKDNQNPDEDPSILYELIGIISHTGSVNEGHYVA
FCKIENGEWFKFNDSMVTKILEKDVLKEQAYLLFYIVKHIS
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggatgattgccagcatattcagtcaatttttgagaatcccaagaatagagcagcttgg
ctaaatgcattaagtactacacagagtgtactacgccattctcctatcaaggcgaagcta
ttgcatgcttttcgatgctcgacttgcaaagagatatccaatggttcgaactttttatgt
cttcaatgtggattctgcggctgctggaacggctcacattttgaacaacatagcaaagag
acaggtcatttatttggcattaatgcacaaaccgaactagtattttgctttcaatgcatg
gactatgttggtgattttgatctatttagagatgcggcattggctaatagatgggactat
tacgaggaatatacaaatgtgccgacagttgatcagatcgatggtatggctggtttagtt
aacatgggatctacatgttacatgagcagtataatgcaatgcattatccataacccatat
atgatacgatacttcatgtgccagcaacatagcaataattgtaccctcaaaatggctagc
aattgtactagctgcgctatttcatcaataatagctgatttctatggcaattcagttcag
aatgattataagagcaagaagaacaataataataaacatgaaggcttcattaatctactt
acctgttcttggaaagttaacgagaatctggctgggtactctcaacaagatgcgcatgaa
tattggcaatttatattaaaccatatccatcaagattacaaaagtagcatgcactcgcat
tctgatgacaaactatgcaactgtgtggttcattcatcattccaaggatcattgaagagt
tcaattgtttgtccagaatgtaataacgactcgaaaacgacatttgatccttttatagac
ctttcattagggattaaagacaaacacacactaacagagtgcttagataattttcacaag
aaagaacaacttcatgattacgacttcttttgcaagaaatgccaagctcaacagaatcca
ataaaacagtttacaatcaataaacttccgccagttttagtacttcagttaaaacggttt
gagcatctaatgagtggtgtaaatcaaaaattaaatgactatatcgaatttcccaaaatt
ttagatatgaaaccttacctaaaggacaaccagaaccctgatgaagatccatcgatatta
tatgaattaatcgggataatttcacatactggatctgtaaatgagggtcactacgttgct
ttttgtaaaatagaaaatggagaatggttcaaattcaatgattctatggttacaaagatc
ctggaaaaagatgtgctaaaagaacaagcatatttattattttatatcgtaaagcatatc
agttaa

DBGET integrated database retrieval system