KEGG   Candida glabrata: CAGL0M11748gHelp
Entry
CAGL0M11748g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
cgr  Candida glabrata
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:cgr04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
M:1168856..1170199
Genome map
AA seq 447 aa AA seqDB search
MATNEEFIRTQIFGTVFEITNRYSDLNPVGMGAFGLVCSATDTLTNQQVAIKKIMKPFAT
AVLAKRTYRELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPLEKQF
VQYFHYQILRGLKYVHSAGVVHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTR
YYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPSDV
IDTICSENTLKFVTSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHP
YLAPYHDPTDEPVAEAKFDWHFNDADLPVDTWRVMMYSEILDFHKIGGTDGQIDTSATFD
DQVAAATVAAAQAQAHALAQAQMSQNMIDPNQLLNEDGTPVSGSIAENSSNSATTNLNGA
AAGMNSASDTINEYANQAVHFANEFQQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggctactaatgaagagttcataagaacccagatattcggcacagtcttcgagataact
aaccgttactcagacttgaaccccgttggtatgggtgccttcgggctggtgtgctcggct
acagacactttgactaaccaacaagtggcaatcaagaagatcatgaagcctttcgccaca
gcggtgctggccaagagaacctacagagaattgaaacttctgaaacatctgagacatgaa
aacttgatctgtctccaggatatcttcctgtcgccactcgaggatatatacttcgtcacc
gagctgcagggaactgatctccaccgcttactacaaaccagacctctagagaagcaattc
gtacagtacttccattatcagatattgagaggtctgaaatacgttcactcagcaggagta
gtccacagagatttgaaaccaagcaatatcctaatcaatgaaaactgtgacctgaagatc
tgtgatttcggacttgcaagaatccaggacccacagatgacaggctacgtctccacaaga
tactacagagcccccgaaatcatgttaacttggcagaaatacgacgtcgaggtcgacata
tggtccgcagggtgcatctttgccgagatgatagaaggtaaacctttgtttccaggtaaa
gaccacgtccaccaattctccatcattactgatctgttgggttctcctccaagtgatgtc
attgacaccatctgttctgaaaacacattgaagttcgtcacttctttaccacatagagac
cctattccattctctgaaagattcaagactgtcgagccggacgcagttgacctactggaa
aaaatgctggtatttgatccaaagaagagaattaccgcagcagatgcattggctcatcca
tatctagcaccatatcacgatcctaccgacgaaccggtagcagaggcaaagtttgactgg
catttcaatgatgcagatctaccagtagacacatggagagttatgatgtactcagaaata
ctggacttccataaaatcggaggcacagatggtcaaatcgatacatccgcaactttcgat
gaccaagttgcagctgctacggtagctgctgctcaagcccaagcacatgcattggcacaa
gcccagatgtctcagaatatgattgacccaaaccaacttctaaatgaagatggtacacca
gtgagtggaagcatagcagagaacagctcgaattctgcaacaactaacctaaacggtgct
gctgcaggtatgaacagtgcaagtgatactatcaatgagtatgctaatcaagcagtgcat
tttgcaaatgaattccaacaataa

DBGET integrated database retrieval system