KEGG   Candida glabrata: CAGL0M13409gHelp
Entry
CAGL0M13409g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
cgr  Candida glabrata
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
M:complement(1317818..1322401)
Genome map
AA seq 1527 aa AA seqDB search
MRHGFEEQYLSEQLLESMADDFLFYFDDKRHRTSGNPTPEEVKSEDAEHYYQPIQDWKII
KDRQKTVSAALLLCLNLGVDPPDVIKTHPSARVEAWVDPLSFQDSKKAIEQIGKNLQAQY
ETLSLRTRYKQSLDPCVEDVKRFCNSLRRQSKDDRILFHYNGHGVPQPTPSGEIWVFNRG
YTQYIPVSLYDLQTWLGAPCVFVYDCSSAGNIVANFQKFVEKRIRDEEAGNPDNAAPSPS
SAYKQCFQLASCRADELLLMSPELPADLFTCCLTCPIEISVKVFLMQSELKDTKYRIFFE
TPTYGSGAKQTSKKSSFRSNIPAVNIPGILSDRRTPLGELNWIFTAITDTIAWTSLPRPL
FKKLFRHDLMIAALFRNFLLAKRIMPWYNCHPISDPELPDSVATHPMWDVWDLAMDEVLG
KLVEDLKHNESSQNLESQLILQQQESLANQTQKNPQSNSNDHRPESIRTESRFTTGNLST
MSLANHPALNTITRKTQAAALNLTRPANQQQYTGFFEQNLTAFELWLKYSSNVRNPPEQL
PIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVLKLLQSPAQELKPILVF
IWARIMSIDYKNTQADLIKEKGYMYFVSILAPDWRVSPSITAGPSFSNGGISMSTMPVMN
GSRTQLYDQQNTRSQVYQSQLHTSSTTDEQKAMAAFVLASFIQDFKSGQMHCFSVELLNK
LSYYILNSDVPLLRQWSILLIGLLYNENPLHKSICMTTGVMDTLVKAIKDPVPEVRTATV
LALKYFISGFDDAEIIIGLQQGLEQQYQQLHTQLQYIHNNIHSQQSQTPQQHQQLEQQQS
KLEQQMHHCQIRQSQLENVDLKKIKQQEIVNLIACLPLRNDGSPLVRKELAIMFSQIVYR
YCNFFIVVVFQELLDEIAQSKGATFDSEEFRGKNSFTKGSVFSIIWKGLLILSADPFTEI
SKIAEKVIDYILLELSVHKDLGEAFSKIEAYLSARSSSLNQSGKLNFGNSQIQIVKKPIG
PMNGKATIPNETIKSTKVSGISKETNGGLFSLLTNFRQRKDETGEEDENKGNILSGMSYI
NTPKVSLPTARAPRSHVGNSTKFPVESTFLEYSREYFQEPQMRKPEAEEAGSEAYIAKLW
RQKRNEGIIEETQKQKKLSLYGDWSNRIRSYDTKSQVKLLKFAQFENYLVSSDDRDAITV
YDWDENKTLARFSNGNPFGTKVTDIKLMNEDDIPLLMVGSSDGLIKIYKNLHSVNDLQLV
TAWRGLSDMLLTPRSNGLLSEWQQSRGSLLVTGDVKIIRVWDALSESLEVDIPAKTSSLF
TSLTSDQVAGNIFVAGFSDGTIRVYDRRTDPRLAMVRRWRGGGGKPGAWINNVHMQRGGY
RELVSGSTNGVVELWDIRHDQPVATYVDENKKDGKRDSTTMVSVQVHEHAPIFATGTKSI
KLWTTSGDILSSFRNSKPIGGIGAASTFAATGIRNTLSNTSSTSAFLSQLAFHPHRMMLA
AANSHDSFVNIYSCEEKRDNIYLPFFK
NT seq 4584 nt NT seq  +upstreamnt  +downstreamnt
atgaggcatggatttgaagagcagtatctgagtgagcaattgttagaatccatggctgat
gattttttgttttactttgatgacaagcgtcataggacatctggaaacccaacaccggaa
gaagtaaagagtgaagatgccgagcattattatcagccaattcaggactggaagattatt
aaagatagacaaaagactgtcagtgcagcattgctcttgtgtctgaatttaggggttgat
ccaccagatgttattaagacacatccgtcggcaagggtggaagcatgggtagatccactt
agttttcaggactctaaaaaggctatagaacaaataggtaagaaccttcaagcacaatat
gagacattatctttaagaaccaggtataaacaaagcctagatccatgtgtggaggacgtt
aagcggttttgtaattcactgagaagacaatccaaggatgacagaattctgtttcattat
aatggtcatggtgtcccacagcctacaccatctggagagatctgggtatttaatagagga
tacacacaatacatcccggtatccttatatgatctgcaaacttggctgggtgcaccttgt
gtttttgtttatgattgtagcagtgccggtaatatagtcgctaattttcaaaaattcgtg
gagaagagaatacgagatgaagaagctggtaatccagataatgcagcaccttctccttcg
tcagcttacaagcaatgtttccagttagcatcgtgtcgtgctgatgaattactattgatg
agtcctgaattaccagcagatttgtttacatgctgtcttacttgtccaattgaaataagt
gtaaaggtattcttaatgcaatctgaattaaaagatacaaagtatagaattttttttgag
actccaacttatggatcaggagcaaaacaaacctcaaagaaaagttctttcaggtcaaat
atccctgcagttaatattccaggtatcttgtcagataggagaactccacttggtgaattg
aattggatttttaccgcaattacagatacaatagcatggacatcactaccgagacctcta
ttcaagaaattgttccgccatgatttaatgatagccgcattgttccgtaactttttgctg
gcaaaaagaataatgccttggtataattgtcatccaatttctgatccggaactaccagac
tcagtggctacgcatccaatgtgggatgtatgggacttagcaatggatgaagttttgggg
aagctagttgaagatttaaaacataacgaatccagtcagaatttagaatctcagttaatt
ttgcagcaacaggagtcccttgctaatcaaactcaaaaaaatccacaatctaactctaac
gatcacagaccagagagtatcagaacggagtcacgatttacaacaggaaatttaagtact
atgtcattagcaaatcatcctgcattgaatacaattacaaggaaaacacaagcagcagct
cttaatttgactaggccagcaaaccagcagcaatacacaggcttttttgaacaaaattta
actgcttttgaactatggttaaaatattcctcgaacgttagaaaccccccagaacagtta
ccaattgtgctacaagtattgttgtcgcaagtgcatagaattagggcattagtactctta
tcacgttttttagatttggggccttgggctgtgtatttatcattatcgataggtatattt
ccatatgtgctaaaactgcttcaaagtcctgcgcaagagttgaaaccaattttagttttt
atttgggctagaataatgtcaattgattataaaaatacacaagcagacctgatcaaggag
aaggggtacatgtatttcgtgtcaattcttgcaccagattggagagtttcaccttcaata
actgcaggcccttctttcagtaacgggggtatatccatgagtactatgcctgtcatgaat
ggttctagaactcaattatatgatcaacaaaatacaagaagtcaggtttaccaatcacag
cttcatacatcctcaacaacagatgagcaaaaagcaatggctgcttttgttttggcatcc
tttattcaggattttaaatctggacagatgcattgcttcagtgtagagctattgaacaaa
ttatcctactatattttgaactctgatgttcctttgttgagacaatggtcaattctacta
attgggttattgtataatgagaatccgttgcataaaagcatatgtatgaccacaggtgta
atggacacacttgtgaaagccataaaggacccagttccagaagtaagaacagcgacagtc
ttggcactgaaatattttatttccggctttgatgatgcagaaattattatcggtctgcaa
cagggtctagaacaacaatatcagcaacttcatacacaactacaatatattcataataac
attcattcccagcaatcacagactcctcagcagcatcagcaacttgaacaacaacaatct
aaactcgaacaacagatgcatcattgtcagatacgtcagtctcagcttgagaatgttgac
ctgaaaaagatcaagcagcaagagattgttaatttgatagcttgtttgcctttgaggaat
gatggatctccactagttaggaaagaactggcaattatgttttctcagattgtatatcgt
tattgcaatttttttattgttgttgtatttcaagaattattggatgaaatagcacagagt
aagggtgcgacgtttgacagtgaggaatttagagggaaaaattcatttactaaaggatct
gtgttcagtataatatggaagggtttgttgattttgtctgctgatccattcacagaaatc
agcaaaatagcagaaaaggtaatagattatatattgctggaattaagcgttcataaggat
cttggagaagcattttcaaaaatcgaagcatatctttcggcaagaagttccagtctaaat
cagagtggaaagctgaattttggtaactctcaaatccaaatagttaaaaagccgatagga
ccaatgaatggtaaagccacaataccaaatgaaactataaaaagtaccaaagtgtcaggc
atctcaaaagagactaatggtgggctttttagtttattgactaatttccgtcaaagaaaa
gatgaaactggtgaagaagatgaaaacaaaggcaatatattatcgggcatgtcttacata
aatacaccaaaagttagtctgcctactgctagagcaccacgttcacatgttggtaattcc
actaagtttccagtggaaagcacgtttcttgaatattctagagagtacttccaagagccg
caaatgcgaaagcctgaagcagaggaagctggaagtgaagcatatattgcaaagctttgg
cgtcaaaaaagaaacgaaggtattattgaggagactcaaaaacagaagaagctttcgttg
tatggagattggagtaatagaattcgtagttacgatacaaaatctcaggtcaaactcctg
aaatttgctcagtttgagaattacttggtatcttcagatgacagagatgcaattacagtg
tatgactgggatgaaaataagacactcgctagattttctaatggaaatccatttgggacc
aaggtaacagatataaaactcatgaatgaggacgatatccctctattaatggtaggttca
tctgatggtttaataaaaatatacaaaaaccttcattcagttaacgatttgcaattagta
actgcctggaggggattatcagacatgttattgactccccgttccaacggtcttctatca
gagtggcaacaaagtagagggtcccttttagttactggtgatgttaaaataattagagtt
tgggatgcactgtcggagagcttggaggtcgatatacctgcgaaaacatcttctttgttt
acgtccttaacatctgatcaagttgctgggaatatatttgtagctggtttttctgatggt
acaattagagtctacgatagaagaacagatccaaggttggcaatggtgaggagatggaga
ggtggtggtggtaaaccgggagcatggattaataatgttcatatgcaaaggggtggctat
agagaattggttagtggttctactaatggtgtagttgagttatgggatatccgtcatgac
caaccagtggctacatatgttgatgaaaataagaaggatggaaagcgtgattccactaca
atggttagtgtacaggtacatgagcatgcacctatttttgctactggtacaaaaagcatc
aagttatggacaacttctggtgatatcctttcgtctttcagaaattccaaaccaattgga
ggtattggtgctgcaagtacatttgctgcaacaggtattcgtaatactctgtccaatacg
tcgtccacttctgcatttttgtctcagttagcgttccatcctcatcgtatgatgttggcg
gccgcaaactcacatgattcttttgttaatatatattcatgtgaagagaaaagagataat
atttacctaccattctttaagtga

DBGET integrated database retrieval system