KEGG   Candida glabrata: CAGL0M13783gHelp
Entry
CAGL0M13783g      CDS       T01024                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
cgr  Candida glabrata
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
M:1354198..1357788
Genome map
AA seq 1196 aa AA seqDB search
MGTNVEEVGEIVETIDLGKSIDEVFPELEEDQEVLVEGSFTWRIDKWSELKEHKYMSPRS
QVGEYQWDVLLFPHGNHNKGLAIYLEPHPEEEKDETTGELKPVDPEWYCCAQFAIALSRP
DDDQEINLVNKSNHRFNSLDTDWGFANFVDLGSLKYPSKGRNRGFLNDDKLNITVFVRIL
KDPTGVLWHNFINYDSKKMTGYVGFRNQGATCYLNSLLQSYFFTKYFRRLVYQIPTENES
PNNSVPLALQRSFYQLQVSKFPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRM
KGTSVEGMLNEIFVGKMKSYIKCIDVDYESSRVEDFWDLQLNVKNMKGLKESFDNYIEIE
LLNGENQYQAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETI
DLSPYLEDSKKEKENNCVYNLHGVLVHAGDISTGHYYTLIKPGLEDQWYRFDDERVWKVT
KNQVFEENYGLDALPDDKLRTMTREQYQEYVLARHTSAYMLVYIRSDREDQLLQPVLESE
VPKHVIERVQEEIKEREEKEREIREAHLYFQIHCYTTEDFIDYQGFDLCAHEKFGFFSQD
LQKRNGSSGLSMRVLRSTKIKDLFGNIKENLDIPHEREVRYWRMTNRRNNTLRLEHPINS
IMDNITLDEALNSEEEGLVSSIDIFVEEPYLELQYLVEQKKNGNLDTAILTKNMIQNLRI
NLDKLVPAESIPTVIDYNSAGQETLFLKIFSKKSQSMRGFGVCTLSQTSKVSEISNLINI
ALETKDEISFIEEIQPGHIEKIEGNDELYMAELGTGDILCFNDPVNDKIDEETSNSIYPP
CQDNVEFYHYLRHRVKIRLSRTNGNDGSNEQDTNGAKAPEAISLWVSAYISYPDFAEAVA
RHVKVNPEFLKVYALYANGRFALKSNSILNDYLLKDYNCDEIPPFEYEILSMPLKELEHL
RPIKFYWLKSSYLHFQCMELEVPNNCTIGEFLDKVQQKLQFTDEDRKNILLWTNHNSQFQ
NVLAEDNTFKNLGKTSLLFGRVLKEEVDLIKGLNDPANSMDSGIDNEIDLVSDSNHQRPV
VNGKLIIVGQYFKDPQNKHGISFLFNLVPGENFIQTRERLHQKFGLGQREFAKVKMVISL
NTSDGTVTKSLQNYTDEELSRIYLFDIMNNLDYIYFDHPDRLKSHNSSDRPMVIKS
NT seq 3591 nt NT seq  +upstreamnt  +downstreamnt
atgggaacaaatgttgaagaagtgggagagatagtagaaacaattgatctagggaagagc
attgatgaggtttttccagaactagaggaagatcaggaagtattggtggaaggctcgttt
acatggagaatagataaatggtccgaactgaaagagcataaatacatgtctcctaggagc
caagtgggagaatatcaatgggatgtattgttattcccacatggtaatcataacaaggga
ttggcgatatacctggagccacatcctgaagaggagaaggatgaaactacgggcgagttg
aagcccgttgatcctgaatggtactgctgtgcacaatttgccattgcattgtcaaggcct
gatgatgaccaagagataaatctggtgaataaatcaaatcataggtttaattctctggat
accgattggggcttcgcaaattttgtagatctaggaagcttgaaatatccatcaaagggg
agaaatagagggtttttgaatgacgataaattgaatataactgtttttgtacggatactg
aaagatccaactggtgtgttgtggcataacttcataaattatgactcaaagaagatgact
ggttatgtcggtttcagaaaccaaggtgctacatgttatctcaactcattattacaatct
tattttttcacaaaatacttcagaagattggtatatcaaatacctactgagaatgagagc
cccaataatagtgtgccgctagctctacaaaggtcattctatcaattacaagtatcgaaa
tttccactagacacattggaactaaccagatcctttgggtgggacagtgcagaagcattc
acacagcatgatgtccaggagctgaatagaatattgatggacagattggagaatagaatg
aaaggcacatcggttgaaggtatgctgaatgaaatctttgtcgggaagatgaagagttat
atcaagtgtatagatgttgattatgaatcttctagggtggaagatttctgggaccttcaa
ttaaacgtgaaaaatatgaagggtttgaaagagtcatttgataactatattgaaattgaa
ttgttaaatggtgagaatcagtatcaagcacaagattatggcttacaggatgcagaaaaa
ggtgtcatatttgaaagtttcccaccggtactgcatttgcaattgaagcgttttgaatat
gactttaattatgatcaaatgataaaagttaatgacagatatgaattcccggaaacgata
gatttgtccccttatttggaagattcaaaaaaagaaaaagaaaataattgtgtatacaat
ttgcacggtgtgttggttcatgccggagacatttcgaccggccactactacacattaatc
aagcctggtttggaagatcaatggtatagattcgatgatgaaagggtttggaaagtaaca
aagaatcaagtcttcgaagagaactatggtttagatgctttgccagatgataagcttaga
acaatgacaagagaacaatatcaggaatatgtccttgctagacatacaagtgcttatatg
ctggtatatattagaagcgacagggaagatcaactattgcaaccggttttagagagtgaa
gtcccaaaacatgttatcgagagggttcaggaagaaattaaggagagagaggaaaaggaa
agagagattagagaagcgcacttgtactttcaaattcattgttataccacggaagacttt
attgactatcaagggtttgacttatgtgctcatgagaaatttggatttttctctcaagat
ttacagaaacggaatggtagtagcgggttaagtatgcgagtgcttaggtcgacaaaaatt
aaagatctatttggaaatataaaagaaaatctagatattccccatgaaagagaggttagg
tattggagaatgactaatagaaggaacaacactctgagacttgaacatccgataaactcg
ataatggataacattacacttgatgaagctttaaattcagaggaagagggcttagtatct
tcgattgatatatttgttgaggaaccctatttagagttgcagtatctagtcgaacaaaag
aaaaatggcaacttggatacggcgattttaacaaaaaatatgattcagaatctaagaata
aatctcgataagttagtaccggctgaaagtattccaacagtcatagattataattcagcc
gggcaagaaactctatttttgaagatattttccaagaaatcacaaagtatgagaggattt
ggtgtatgcacattaagtcaaacttctaaggtaagtgaaatttctaatttaattaatatt
gcgttggaaaccaaagatgagatttcattcattgaagagattcaaccgggacatattgag
aaaattgagggcaacgatgaactgtatatggctgaattaggaacgggtgacattttatgt
tttaatgaccccgtaaatgacaagatcgacgaggaaacttcaaattccatatatccacca
tgtcaagataatgtggagttttaccactatttgaggcaccgtgttaagattaggctttca
aggacaaatggtaatgatggaagtaatgagcaagacacaaatggggccaaggctccagag
gcgatatcgctttgggtttccgcttatatttcttaccctgattttgcagaagcagtcgca
aggcatgtcaaggtgaacccggaatttttgaaggtgtacgcactgtatgctaacggcaga
tttgcactgaaatcaaactctatcttgaatgattatttactaaaggattataattgcgat
gaaatacctccttttgaatatgagatactttcgatgccattgaaagagctcgaacatttg
agacctattaaattttactggttaaaatcaagttatttacattttcaatgtatggaatta
gaggttcccaataactgtaccataggtgaatttctagacaaggtccaacaaaagttgcag
tttacagatgaggatcggaaaaatatattattgtggactaatcataattctcagtttcaa
aatgtcctcgctgaagacaatacctttaagaatctaggaaaaacatctttactatttgga
agggttttgaaagaagaggttgatctgatcaagggactaaatgatccagccaactccatg
gattccggaattgataatgaaattgatttggtatctgactcaaatcatcagagacctgta
gttaatgggaagttaatcattgttggccagtatttcaaagatccacaaaataagcatggt
atttctttcttatttaacctggtacctggagaaaattttatacagacaagagagcgacta
catcaaaaatttggacttggtcaaagagaatttgcgaaagttaagatggtcatttctttg
aatacctcagacggtaccgtaacaaaatctctgcagaactacactgacgaagagttgtca
aggatttatttatttgacattatgaacaatttagactatatctattttgatcatcccgat
agattaaagtcccataattccagtgataggccgatggttataaaaagctaa

DBGET integrated database retrieval system