KEGG   Corynebacterium glutamicum SCgG1: C624_02540Help
Entry
C624_02540        CDS       T02690                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cgs  Corynebacterium glutamicum SCgG1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cgs00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
549142..550488
Genome map
AA seq 448 aa AA seqDB search
MRFAIIGAGLAGLTAAYEIHKADPTAQIDVLEAGERIGGKLFTVPFASGPTDIGAEAFLA
ARSDAVEFFTELGLADSLVSPSAAKSQYFAGGALHAFPAGGVMGIPSNPPAGAQDTAFDW
TPGHDISVGALVRRQYGDEIVDTVVSSLLGGVYSSTADDLGVRASVPALAAALDQLAEAG
EPVTLSAAVKAVEAQREAAKTTSETRPVFQTFKGGYAELYEALAEQCGADIHLDSFVSAI
TKDGEGFAIKGGGEGAYDKVILAVPAPTAAVLLRDLAPAAAPHLRAIKLASSAVVGMRFD
SSEGLPDNSGVLVAVNEPGITAKAFTFSSKKWPHLEARGGALVRASFGRLGDEASARMDE
DLLVDAALDDLLTITGFDGRAAGLGEIFVQRWFGGLPAYGVDHIATVSAARAEIAAVPGV
EAIGAWAGGVGVPAVIADAQAAVHRLLG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgccatcatcggtgcaggccttgcgggtctgactgctgcatatgagatccat
aaagctgatcccactgcccaaatcgatgtgttggaagcaggcgaacgcattggcggcaag
ctttttacggtgccgtttgcttccggacctaccgatattggagcggaggcgtttttagct
gcgcgttccgatgcggtggagttttttactgagcttgggttggctgattctttggtcagc
ccgtctgctgcgaagtctcagtatttcgcgggcggtgcgctgcatgcgttccccgcaggt
ggagtgatgggtattccaagcaatccaccagcaggcgcgcaagacaccgcttttgattgg
actcctggccacgatatttctgttggcgccttagtgcgccgtcagtatggcgatgagatc
gtcgatactgtggtgtcttcgctgcttggtggcgtttattcgtccacagctgatgatctg
ggtgtgcgcgcttccgtgccggcacttgctgcagcccttgatcagctggctgaggccggc
gagccggtgactctgtcagctgcggtcaaggccgtggaagctcagcgggaagccgcaaaa
acaacttcagaaacccgccccgttttccagacctttaagggcggatacgcggagctgtac
gaagcgttggcagagcaatgcggtgcagatattcacttggatagtttcgtttccgccatc
accaaagatggtgaaggttttgccatcaagggcggtggcgaaggtgcctacgacaaggtg
attttggcggttcccgctccaaccgccgctgtgctgctccgcgacttggcaccggccgca
gcgccacatttgcgcgcaattaagttggcttcttcagcagtcgtcggcatgcgtttcgat
tccagcgagggcctgcccgacaactccggcgtcctggtcgctgttaatgagccgggcatc
acggcgaaggccttcaccttctcctcaaagaagtggcctcacctggaggctcgcgggggc
gcgctcgtgcgcgcgtcgttcggcaggctaggcgatgaggcgtcggcacgcatggacgag
gatttgcttgtcgacgccgccctcgacgatctcctcaccataaccgggttcgacggccgg
gctgccggactgggtgaaattttcgtgcagcgctggttcggtgggctcccagcctatgga
gttgatcacattgctaccgtttcggctgcgcgtgcagagatcgcagccgtgcctggcgtg
gaagcaattggcgcgtgggctgggggagtgggagttcccgcagttatcgcagatgcccag
gcagcagtacacaggttgctgggataa

DBGET integrated database retrieval system