KEGG   Corynebacterium glutamicum SCgG1: C624_07640Help
Entry
C624_07640        CDS       T02690                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cgs  Corynebacterium glutamicum SCgG1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cgs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C624_07640
Enzymes [BR:cgs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     C624_07640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1624954..1625877)
Genome map
AA seq 307 aa AA seqDB search
MSNSTGTDIVVVGSINADLTALVHRHPEPGETLLGSGGAVSAGGKGANQAVAAAQLGAKV
TMIGAVGTDQMAGEALTHLRQSGADMSAIATVDGPTGLAIITVSDDGENTIIVIPGANAS
VTAEFVNQHSQLIEDAGIVLLQGEIPADGFERAVDLSQGRVVINLAPVVPVGHAQLRRAD
PLLVNEHEGALVLDMLGTPATTSNPQGLVTELLEQGFASVVMTLGAEGALVGTPGQLTAI
PTPKIQAVDTTGSGDAFAGALVAKLSEGAGLIEAATFAARVGAYAATKPGAQASYPTLTT
ELPSTTH
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactcaaccggtaccgacattgtcgttgtcggatccatcaatgccgatctcacc
gccctagttcaccgccaccctgaacctggagaaaccctcctgggcagtggcggtgcagtt
agtgctggtggcaaaggcgccaaccaagccgtggcggcagcgcaactaggtgccaaagtc
accatgatcggtgcggtcggaactgatcaaatggctggcgaggcgctgacacacctgcgt
caatcaggagcagatatgtccgcgattgccactgtggatggccccacgggtcttgccatc
atcactgtgtctgatgatggtgaaaacaccatcatcgttatccctggcgctaacgcttct
gtcaccgcggaatttgttaatcaacactcccagctcattgaggatgccggcattgtgttg
cttcagggtgagatccctgccgatggtttcgagcgtgccgttgatctttcacaaggacgt
gtggtgatcaatctggctccagttgtgcccgtgggacatgctcagctgcgtcgagctgat
ccactgctggtcaacgaacacgaaggcgctctggtgctggacatgctcggaactccagcg
accacgtctaatccccaaggtttggtcactgaattgctggagcagggttttgcttccgtg
gtgatgacacttggtgccgaaggtgctctggttggcactccgggccaactcacggcaatc
cctaccccaaaaatccaggcagtcgacacaaccggaagtggagacgcgtttgcgggggca
ctcgtcgcaaagctctctgaaggcgctggccttatagaggccgcaacttttgctgcgcgc
gttggcgcttatgccgccaccaagccgggcgctcaagcctcctaccccaccctgaccact
gaactcccctcaaccactcactga

DBGET integrated database retrieval system