KEGG   Corynebacterium glutamicum SCgG1: C624_10055Help
Entry
C624_10055        CDS       T02690                                 

Definition
glutamate dehydrogenase (EC:1.4.1.4)
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
cgs  Corynebacterium glutamicum SCgG1
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgs00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    C624_10055
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C624_10055
   00330 Arginine and proline metabolism
    C624_10055
Enzymes [BR:cgs01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     C624_10055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2171894..2173237)
Genome map
AA seq 447 aa AA seqDB search
MTVDEQVSNYYDMLLKRNAGEPEFHQAVAEVLESLKIVLEKDPHYADYGLIQRLCEPERQ
LIFRVPWVDDQGQVHVNRGFRVQFNSALGPYKGGLRFHPSVNLGIVKFLGFEQIFKNSLT
GLPIGGGKGGSDFDPKGKSDLEIMRFCQSFMTELHRHIGEYRDVPAGDIGVGGREIGYLF
GHYRRMANQHESGVLTGKGLTWGGSLVRTEATGYGCVYFVSEMIKAKGESISGQKIIVSG
SGNVATYAIEKAQELGATVIGFSDSSGWVHTPNGVDVAKLREIKEVRRARVSVYADEVEG
ATYHTDGSIWDLKCDIALPCATQNELNGENAKTLADNGCRFVAEGANMPSTPEAVEVFRE
RDIRFGPGKAANAGGVATSALEMQQNASRDSWSFEYTDERLQVIMKNIFKTCAETAAEYG
HENDYVVGANIAGFKKVADAMLAQGVI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgatgagcaggtctctaactattacgacatgcttctgaaacgcaatgctggc
gagcctgaatttcaccaggcagtggcagaggttttggaatctttgaagatcgtcctggaa
aaggaccctcattacgctgattacggtctcatccagcgcctgtgcgagcctgagcgtcag
ctcatcttccgtgtgccttgggttgatgaccagggccaggtccacgtcaaccgtggtttc
cgcgtgcagttcaactctgcacttggaccatacaagggcggcctgcgcttccacccatct
gtaaacctgggcattgtgaagttcctgggctttgagcagatctttaaaaactccctaacc
ggcctgccaatcggtggtggcaagggtggatccgacttcgaccctaagggcaagtccgat
ctggaaatcatgcgtttctgccagtccttcatgaccgagctgcaccgccacatcggtgag
taccgcgacgttcctgcaggtgacatcggagttggtggccgcgagatcggttacctgttt
ggccactaccgtcgcatggctaaccagcacgagtccggcgttttgaccggtaagggcctg
acctggggtggatccctggtccgcaccgaggcaactggttacggctgcgtttacttcgtg
agtgaaatgattaaggctaagggcgagagcatcagcggccagaagatcatcgtttccggt
tccggcaacgtagcaacctacgcgattgaaaaggctcaggaactcggcgcaaccgttatt
ggtttctccgattccagcggttgggttcatacccctaacggcgttgacgtggctaagctc
cgcgaaatcaaggaagttcgccgcgcacgcgtatccgtgtacgccgacgaagttgaaggc
gcaacctaccacaccgacggttccatctgggatctcaagtgcgatatcgctcttccttgt
gcaactcagaacgagctcaacggcgagaacgctaagactcttgcagacaacggctgccgt
ttcgttgctgaaggcgcgaacatgccttccacccctgaggctgttgaggtcttccgtgag
cgcgacatccgcttcggaccaggcaaggcagctaacgctggtggcgttgcaacctccgct
ctggagatgcagcagaacgcttcgcgcgattcctggagcttcgagtacaccgacgagcgc
ctccaggtgatcatgaagaacatcttcaagacctgtgcagagaccgcagcagagtatgga
cacgagaacgattacgttgtcggcgctaacattgctggcttcaagaaggtagctgacgcg
atgctggcacagggcgtcatctaa

DBGET integrated database retrieval system