KEGG   Corynebacterium glutamicum SCgG1: C624_11100Help
Entry
C624_11100        CDS       T02690                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cgs  Corynebacterium glutamicum SCgG1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C624_11100
Enzymes [BR:cgs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     C624_11100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2404880..2407000
Genome map
AA seq 706 aa AA seqDB search
MTARRLLNELADLYGVATSYTDYKGAHIEVSDDTLVKILRALGVHLDTSNLPNDDAIQRQ
IALFHDREFTRPLPPSVVAVEGDELVFPVHVHDGSPADVHIELEDGTQRDVSQVENWTAP
REIDGIRWGEASFKIPGDLPLGWHKLHLKSNERSAECGLIITPARLSTADKYLDSPRSGV
MAQIYSVRSTLSWGMGDFNDLGNLASVVAQDGADFLLINPMHAAEPLPPTEDSPYLPTTR
RFINPIYIRVEDIPEFNQLEIDLRDDIAEMAAEFRERNLTSDIIERNDVYAAKLQVLHAI
FEMPRSSEREANFVSFVQREGQGLIDFATWCADRETAQSESVHGTEPDRDELTMFYMWLQ
WLCDEQLAAAQKRAVDAGMSIGIMADLAVGVHPGGADAQNLSHVLAPDASVGAPPDGYNH
QGQDWSQPPWHPVRLAEEGYIPWRNLLRTVLRHSGGIRVDHVLGLFRLFVMPRMQSPATG
TYIRFDHNALVGILALEAELADAVVIGEDLGTFEPWVQDVLAQRGIMGTSILWFEHSPSQ
PGPRRQEEYRPLALTSVTTHDLPPTAGYLEGEHIALRERLGVLNTDPAAEDAEDLQWQAE
ILDVAASANALPAREYVGLERDQRGELVELLEGLHTFVAKTPSALTCVSLVDMVGEKRAQ
NQPGTTRDMYPNWCIPLCDNEGNSVLIESLRENELYHRVAKASKRD
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
gtgactgctcgcagacttttgaatgaactcgccgatctctacggcgtagcaacttcctac
actgattacaaaggtgcccatattgaggtcagcgatgacacattagtgaaaatcctgcgt
gctctgggcgtgcatttagatacaagcaacctccccaacgatgacgccatccaacgccaa
attgccctcttccatgatcgagagttcactcgcccactgcctccatcggtggttgcagtt
gaaggtgatgaactagttttcccggtgcatgtgcacgacggttcccctgcagatgtccac
atcgaattggaagacggcacgcagcgggatgtttctcaggtggaaaactggacagcgcca
cgggaaattgatgggattaggtggggcgaggcatcgtttaagattcctggtgatctcccc
ttgggttggcacaagcttcaccttaaatccaatgaacgctcagctgagtgcggtttgatc
atcaccccggctcgtctgtctactgctgataagtatcttgattcccctcgcagtggtgtc
atggcgcagatctactctgtgcgttccacgttgtcgtggggcatgggtgatttcaatgat
ttaggaaacttggcaagtgtggttgcccaggatggagcagacttcctgctcatcaacccc
atgcacgctgcagagccactgcctcctactgaggactctccttatctgcccacaaccagg
cgctttatcaacccgatctacattcgggtagaagatattccggagtttaatcagcttgag
attgatctacgcgatgatatcgcagagatggctgcggaattccgcgaacgcaatctgacc
tcagacatcattgagcgcaatgacgtctacgctgcaaagcttcaagtgctgcacgccatt
tttgaaatgcctcgttccagcgaacgtgaagccaactttgtctccttcgtgcaacgcgaa
ggccaaggtcttattgatttcgccacctggtgcgcagaccgcgaaactgcacagtctgaa
tctgtccacggaactgagccagaccgcgatgagctgaccatgttctacatgtggttgcag
tggctatgtgatgagcagctggcggcagctcaaaagcgcgctgtcgatgccggaatgtcg
atcggcatcatggcagacctggcagttggtgtgcatccaggtggtgctgatgcccagaac
ctcagccacgtacttgctccggatgcgtcagtgggcgccccaccagatggatacaaccac
cagggccaagactggtcccagccaccatggcatccagtgcgtcttgcagaggaaggctac
attccgtggcgtaatctgctgcgcactgtgctgcgtcattccggcggaatccgcgtggac
cacgttcttggtttgttcaggctctttgtcatgccacgcatgcaatcccctgctacgggc
acctatatccgcttcgaccataatgcgttggtaggcattctagccctagaagcagaactc
gcagacgccgttgtcattggtgaagatctgggaacgtttgagccttgggtacaagatgta
ttggctcagcgtggcatcatgggcacctcgatcctatggttcgagcattccccaagccag
ccgggtcctcgccgccaggaagagtatcgtccgctggccttgacctctgtgaccactcat
gatctccctccgactgctggttatttggagggcgagcacattgctcttcgtgagcgattg
ggtgtgctcaacactgatcctgctgcagaagacgctgaggatctgcagtggcaagcggag
atccttgatgtcgcagcatctgccaacgcattgccagcccgggaatacgtgggactcgaa
cgcgatcagcgcggtgagttggttgagctgttggaaggcctgcacactttcgttgcgaaa
accccttcagcactgacctgtgtctccttggtagacatggtcggtgaaaagcgggcacag
aatcagccgggcacaacgagggatatgtatcccaactggtgtatcccactgtgtgacaac
gaaggcaactccgtgctcattgaatcgctgcgtgaaaatgagctgtatcaccgtgtggcg
aaggcaagcaagcgagattag

DBGET integrated database retrieval system