KEGG   Corynebacterium glutamicum R: cgR_0316Help
Entry
cgR_0316          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K06187  
recombination protein RecR
Organism
cgt  Corynebacterium glutamicum R
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    cgR_0316
DNA repair and recombination proteins [BR:cgt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     cgR_0316
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      cgR_0316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
345315..345971
Genome map
AA seq 218 aa AA seqDB search
MFEGPLQDLIDELSRLPGVGPKSAQRIAFHLLNVDPTDITRLQEALGGVRDGVQFCRICC
NISREEVCRICSDSGRDGGTICVVEEPKDIQVIERTGEFSGRYHVLGGALDPLANIGPRE
LNISTLLQRIGGVLPDRELADSTPENKLFDATPTVREVILATDPNTEGEATASYLGRLLK
DFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLQI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgaaggcccactccaggatctcatcgacgaactttctcgtctccccggcgtcggc
cccaaaagcgcccaacgcatcgcatttcacctgctcaacgtagatcctaccgatatcacc
cgccttcaggaagccctcggaggcgtgcgtgatggcgtccaattctgccgcatctgctgc
aatatttcccgcgaagaagtctgccgcatctgctccgattctggacgcgacggcggaaca
atctgtgtcgtcgaagaaccaaaagacatccaagttatcgagcgcaccggcgaattctcc
ggccgctaccacgtcctcggcggcgccctcgacccgctggccaacatcggcccccgcgaa
ctcaacatttccacgctcctgcagcgcatcggcggcgtcctgccagaccgcgagctcgcg
gattccactcctgaaaataagcttttcgacgccacccccaccgtccgcgaagtcatcctc
gcaacggaccccaacaccgaaggcgaagccaccgcctcatacctcggccgcctcctcaaa
gacttcccagatctcgtagtttcccgcctcgcatccggaatgccactaggcggcgacctc
gaattcgtcgacgaactcactctctcccgagcattgagtggccgcctgcagatctag

DBGET integrated database retrieval system