KEGG   Corynebacterium glutamicum R: cgR_0440Help
Entry
cgR_0440          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    cgR_0440
   00052 Galactose metabolism
    cgR_0440
   00500 Starch and sucrose metabolism
    cgR_0440
   00520 Amino sugar and nucleotide sugar metabolism
    cgR_0440
Enzymes [BR:cgt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     cgR_0440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
492413..493336
Genome map
AA seq 307 aa AA seqDB search
MSLPIDEHQNAVKTVVVPAAGMGTRFLPATKTIPKELLPVVDTPGIELVAKEAADLGASR
LAIITAPNKDGILKHFEPFPELEATLEARGKTDQLNKVRAARELIDTVPVVQEKPLGLGH
AVGLAESVLDQDEDVVAVMLPDDLVLPFGVTERMAEVRAKFGGSVLAAIEVAEDEVSSYG
IFELGDLDAESESEGIRRVVGMVEKPAPEDAPSRFAATGRYLLDRAIFDALRRIEPGAGG
ELQLTDAIALLIEEGHPVHIVVHEGKRHDLGNPAGYIPAVVYFGLRHAEYGSRIHRAVKE
ILAEFES
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgccaatcgatgagcatcaaaatgctgtaaaaactgttgttgtacctgccgct
ggaatgggcacacgcttccttcccgctaccaagacgatccccaaggaacttcttcctgtg
gttgatactccgggtattgagcttgttgctaaagaagctgcggatctcggggcatctcga
ctggctattattactgcgccaaacaaagacggaattcttaagcactttgagcctttccct
gagcttgaggcaactttggaagctcgcggcaagacagatcagctgaacaaagttcgagcg
gccagggagctgatcgatactgttcctgtggttcaggaaaagccactgggacttggtcat
gcagtcggcctcgcggagtcagtgcttgatcaggacgaagatgttgttgcagtcatgctt
cctgatgatttggtcctgcctttcggcgtgactgaaaggatggctgaagttcgcgccaag
tttggtggatccgtacttgcagctattgaagtggctgaggatgaagtctccagctatggc
atttttgagctcggggatctagatgcggaatcggaaagcgaaggcattcgacgtgtcgta
ggaatggtcgagaagcctgcgcctgaagatgctccatcaaggtttgcggctactggccgt
tatcttcttgatcgtgctatttttgatgcacttcgtcgcattgagcctggtgccggtggg
gaactgcagttaacagatgccattgcattgttgattgaagaaggccacccagtccacatt
gtggttcatgaaggaaagcgccatgatctcggaaacccagctggctatatcccggctgtt
gtgtacttcgggcttcgccacgcagagtacggttccagaattcaccgtgcagtgaaggaa
attctcgctgagtttgaatcttaa

DBGET integrated database retrieval system