KEGG   Corynebacterium glutamicum R: cgR_0474Help
Entry
cgR_0474          CDS       T00501                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cgR_0474 (gpmA)
   01230 Biosynthesis of amino acids
    cgR_0474 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cgR_0474 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    cgR_0474 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cgR_0474 (gpmA)
Enzymes [BR:cgt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     cgR_0474 (gpmA)
Exosome [BR:cgt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   cgR_0474 (gpmA)
  Exosomal proteins of melanoma cells
   cgR_0474 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
530270..531016
Genome map
AA seq 248 aa AA seqDB search
MTNGKLILLRHGQSEWNASNQFTGWVDVNLTEQGEAEAKRGGELLVEAGVLPGVVYTSLL
RRAIRTANIALNAADRHWIPVIRDWRLNERHYGALQGLDKAATKEKYGDDQFMEWRRSYD
TPPPELADDAEYSQANDPRYADLDVVPRTECLKDVVVRFVPYFEEEILPRAKKGETVLIA
AHGNSLRALVKHLDGISDADIAELNIPTGIPLVYEIAEDGSVVNPGGTYLDPEAAAAGAA
AVANQGNK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactaacggaaaattgattcttcttcgtcacggtcagagcgaatggaacgcatccaac
cagttcactggatgggtcgacgtcaatctgaccgaacagggtgaggctgaggccaagcgc
ggaggcgaactcctcgtcgaggcaggcgtcctcccaggcgttgtatacacctccttgctg
cgtcgcgcgatccgcaccgcaaacatcgcactgaacgctgcagaccgccactggatccca
gtgatccgcgactggcgcctcaacgagcgtcactacggtgctctgcagggcctcgacaag
gctgcaaccaaggaaaagtacggcgacgaccagttcatggaatggcgccgctcctacgac
accccaccaccagagctcgcggatgacgcagagtactcccaggcaaatgaccctcgttac
gcggacctcgacgtagttccacgcaccgaatgcctcaaggacgttgtggttcgttttgtt
ccttacttcgaggaagaaatcctgccacgcgcaaagaagggcgaaaccgtcctcatcgca
gcacacggcaactccctgcgtgcactggttaagcaccttgacggcatctccgatgctgat
atcgcagagctcaacatcccaaccggcatcccactggtctacgaaatcgccgaagacggt
tccgtagtaaacccaggcggcacctacctcgatcctgaggcagcagcagccggcgcagca
gcagtagcaaaccagggtaataagtag

DBGET integrated database retrieval system