KEGG   Corynebacterium glutamicum R: cgR_0525Help
Entry
cgR_0525          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K13877  
2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    cgR_0525
   00053 Ascorbate and aldarate metabolism
    cgR_0525
Enzymes [BR:cgt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     cgR_0525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(584437..585999)
Genome map
AA seq 520 aa AA seqDB search
MITATALHGCSLIDGEWVAGKNGEITGFDPRTNASLNPSYSLANRAQLRAATTSAKRAFE
SYRLTTPEVRADFLDSIADNIDDLTEEIVQRASLETGLGTTRLTGEVARTSNQLRLFAET
VRSGQFHRVRIERGPRIDLRQRQVPLGPVAVFGASNFPLAFSTAGGDTASALAAGCPVVF
KAHNAHPGTAELVGQAVRGAVEKHEFDAGVFNLVYGRGVEIGQELAADPNITAIGFTGSR
QGGLALSQTAFSRPVPVPVFAEMSATNPVFVFPGALADLDASSSLAEAFTASVTGSSGQL
CTKPGLVFIPRGVAGDAFVELVAAKFKETTGQTMLTQGIAQAWQRGVDNLAAQPSVKILA
QGTPGDGENAPGPVVFESDVQALLNNAVLQEEIFGAASLVVRYDSPDQLHQVANSLEGQL
TATIHASQDDFQEVSEIIPLLEDLAGRVLYGGWPTGVEVGHTVIHGGPYPATSNAQSTSV
GTLAIERFMRPVSYQTFPAELLPDPVSEVNKWAVPREIDR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgattaccgcaaccgcactgcatgggtgttcactgattgatggcgagtgggtcgctgga
aaaaatggtgagattacaggattcgatccgcgcaccaatgcgagcctgaacccttcctac
tctttagcaaaccgcgcacagctgcgcgccgccacaacatcggcgaagcgagcgtttgaa
agctaccgcctcactactccagaggtcagagcagatttcctggattccatcgcggacaac
atcgatgacttaaccgaagagatcgtgcaacgggcgagcctggagacaggtttgggaacc
acccgactcacaggcgaagtagcccgcaccagcaaccagctccgcctgtttgcagaaacc
gtgagaagcggacagttccaccgagtacgcattgaacgaggaccgcggattgatcttcgc
cagcgtcaggttccgttgggaccagtcgcggtattcggggcaagcaacttccccctcgct
ttctctactgcaggtggcgatacagcatcagcgttggctgcaggctgccctgtggttttt
aaggcgcataatgcgcaccctggaaccgctgagctcgtcgggcaagcggtgcggggagcc
gtcgaaaagcatgagtttgatgctggtgtgtttaaccttgtctacggccgtggcgtggaa
attggccaggagctggctgcggatccgaatatcacggcaatcggttttaccggttcacgc
cagggtggtttggcactgtcacagactgcgtttagccgcccagttcccgttccagtcttt
gcagaaatgagtgccaccaaccctgtgttcgtcttccccggcgcgctggcggatttggat
gcatcgagttccttggctgaggcgtttaccgcttctgtcacaggcagctctgggcaattg
tgtacaaaacccggtctagtttttatcccgcgcggtgttgctggcgatgcttttgtagag
cttgtggctgccaaatttaaagaaaccacgggtcaaacgatgctcacgcaaggcattgcc
caggcgtggcagcgcggagtggacaaccttgcagcacaaccaagcgtaaaaatcctcgcc
caaggcacccccggagatggagagaacgcgccgggcccggtggtgtttgaaagcgatgtg
caagctttgttaaataatgcggtgttgcaggaggaaatcttcggcgcagcatccctggtg
gtgcgttatgattccccggatcaacttcaccaagtagccaattcactcgagggacaatta
actgccacgattcacgcatcccaggatgatttccaggaagtctcggaaattatccccctc
ttggaggatctcgcgggccgtgttctttatggcggctggccaacgggtgtggaagttggg
cacacggttatccatggaggcccttatccggcgacctcaaatgcgcagtcgacaagtgtt
ggaaccctggcaatcgagagatttatgcgcccggtttcttatcaaactttcccggctgag
ctgcttccagatccagtttctgaggtaaataaatgggctgtacctcgggaaatagaccgt
taa

DBGET integrated database retrieval system