KEGG   Corynebacterium glutamicum R: cgR_0525Help
Entry
cgR_0525          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K14519  
NADP-dependent aldehyde dehydrogenase [EC:1.2.1.4]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Caprolactam degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:cgt01220]
Metabolism; Xenobiotics biodegradation and metabolism; Caprolactam degradation [PATH:cgt00930]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(584437..585999)
Genome map
AA seq 520 aa AA seqDB search
MITATALHGCSLIDGEWVAGKNGEITGFDPRTNASLNPSYSLANRAQLRAATTSAKRAFE
SYRLTTPEVRADFLDSIADNIDDLTEEIVQRASLETGLGTTRLTGEVARTSNQLRLFAET
VRSGQFHRVRIERGPRIDLRQRQVPLGPVAVFGASNFPLAFSTAGGDTASALAAGCPVVF
KAHNAHPGTAELVGQAVRGAVEKHEFDAGVFNLVYGRGVEIGQELAADPNITAIGFTGSR
QGGLALSQTAFSRPVPVPVFAEMSATNPVFVFPGALADLDASSSLAEAFTASVTGSSGQL
CTKPGLVFIPRGVAGDAFVELVAAKFKETTGQTMLTQGIAQAWQRGVDNLAAQPSVKILA
QGTPGDGENAPGPVVFESDVQALLNNAVLQEEIFGAASLVVRYDSPDQLHQVANSLEGQL
TATIHASQDDFQEVSEIIPLLEDLAGRVLYGGWPTGVEVGHTVIHGGPYPATSNAQSTSV
GTLAIERFMRPVSYQTFPAELLPDPVSEVNKWAVPREIDR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgattaccgcaaccgcactgcatgggtgttcactgattgatggcgagtgggtcgctgga
aaaaatggtgagattacaggattcgatccgcgcaccaatgcgagcctgaacccttcctac
tctttagcaaaccgcgcacagctgcgcgccgccacaacatcggcgaagcgagcgtttgaa
agctaccgcctcactactccagaggtcagagcagatttcctggattccatcgcggacaac
atcgatgacttaaccgaagagatcgtgcaacgggcgagcctggagacaggtttgggaacc
acccgactcacaggcgaagtagcccgcaccagcaaccagctccgcctgtttgcagaaacc
gtgagaagcggacagttccaccgagtacgcattgaacgaggaccgcggattgatcttcgc
cagcgtcaggttccgttgggaccagtcgcggtattcggggcaagcaacttccccctcgct
ttctctactgcaggtggcgatacagcatcagcgttggctgcaggctgccctgtggttttt
aaggcgcataatgcgcaccctggaaccgctgagctcgtcgggcaagcggtgcggggagcc
gtcgaaaagcatgagtttgatgctggtgtgtttaaccttgtctacggccgtggcgtggaa
attggccaggagctggctgcggatccgaatatcacggcaatcggttttaccggttcacgc
cagggtggtttggcactgtcacagactgcgtttagccgcccagttcccgttccagtcttt
gcagaaatgagtgccaccaaccctgtgttcgtcttccccggcgcgctggcggatttggat
gcatcgagttccttggctgaggcgtttaccgcttctgtcacaggcagctctgggcaattg
tgtacaaaacccggtctagtttttatcccgcgcggtgttgctggcgatgcttttgtagag
cttgtggctgccaaatttaaagaaaccacgggtcaaacgatgctcacgcaaggcattgcc
caggcgtggcagcgcggagtggacaaccttgcagcacaaccaagcgtaaaaatcctcgcc
caaggcacccccggagatggagagaacgcgccgggcccggtggtgtttgaaagcgatgtg
caagctttgttaaataatgcggtgttgcaggaggaaatcttcggcgcagcatccctggtg
gtgcgttatgattccccggatcaacttcaccaagtagccaattcactcgagggacaatta
actgccacgattcacgcatcccaggatgatttccaggaagtctcggaaattatccccctc
ttggaggatctcgcgggccgtgttctttatggcggctggccaacgggtgtggaagttggg
cacacggttatccatggaggcccttatccggcgacctcaaatgcgcagtcgacaagtgtt
ggaaccctggcaatcgagagatttatgcgcccggtttcttatcaaactttcccggctgag
ctgcttccagatccagtttctgaggtaaataaatgggctgtacctcgggaaatagaccgt
taa

DBGET integrated database retrieval system