KEGG   Corynebacterium glutamicum R: cgR_0582Help
Entry
cgR_0582          CDS       T00501                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    cgR_0582
   00650 Butanoate metabolism
    cgR_0582
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    cgR_0582
   00280 Valine, leucine and isoleucine degradation
    cgR_0582
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    cgR_0582
Enzymes [BR:cgt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     cgR_0582
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     cgR_0582
Amino acid related enzymes [BR:cgt01007]
 Aminotransferase (transaminase)
  Class III
   cgR_0582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
642021..643367
Genome map
AA seq 448 aa AA seqDB search
MEDLSYRIPQSRTVAEQVPGPKSKALDERRQAAVARALAPGLPGYVVDADGGILADADGN
RFIDLASGIAVTTVGGSNAAVAKAVGAAAARFTHTCFMVSPYETYVAMAERLNALTPGDH
DKKSALFNSGAEAVENAVKVARAYTGKGAVVVFDNAYHGRTNLTMAMTAKNRPYKSGFGP
LAADVYRAPMSYPLRDGLSGPEAAERAISVIESQVGAENLACVVIEPIQGEGGFIVPAPG
FLAAISTWCRENDVVFIADEIQSGFLRTGDWFASDAEGVIPDVITTAKGIAGGMPLSAVT
GRAEIMDAPGPGALGGTYGGNPVACAAALAAIEVMEQADLKTRAQEIEAIIRDEFAQLSA
FPEVAEIRGRGAMMAIELIDATGRPNAALTAAVAARAKAEGVLLLTCGTDGNVIRLLPPL
VIAEDTLRDGLQVLVAALERETAHQKVG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtggaagatctctcataccgcatcccgcagtcgcgcaccgtggccgagcaggtgccaggg
ccgaagtcgaaagcgctggatgagcgtcgacaagcagcagtagcacgagcacttgcaccg
ggtctgcctggatacgtggtggacgcagacggtggcatcttggctgacgcggacggcaac
cgtttcatcgacctggcctccggcatcgccgtgaccacagtcggcggatccaacgcggcc
gtcgcgaaagccgtcggcgccgcagctgcccgcttcacccacacctgcttcatggtctca
ccttatgaaacttacgtggcaatggcggagagactcaacgccttgactccaggcgatcac
gacaagaagagcgcgctgtttaactctggcgccgaagccgtggaaaacgccgtcaaggtg
gcacgcgcctacaccggcaagggcgcggtcgtggtgttcgacaacgcgtaccacggacgg
accaacctcaccatggcgatgaccgcgaagaaccgcccatacaagtccggattcggacca
ctagccgcagacgtctaccgtgcaccaatgtcttacccactgcgcgacggactgtccggc
ccggaagccgcagagcgcgcgatctccgtgatcgaatcccaggtcggagccgaaaacctc
gcctgcgtggtcattgaaccgatccagggcgaaggcggattcatcgtccccgcaccagga
ttcctcgcagccatttccacctggtgccgcgagaacgacgtggtgttcatcgccgatgaa
atccaatctggcttcctgcgcaccggcgactggttcgccagcgacgcagaaggtgtgatc
cccgacgtcatcaccaccgcaaaaggcatcgccggcggcatgccactatccgcagtgacc
ggccgcgcagaaatcatggacgcacccggccccggcgcgctcggcggaacctacggcgga
aaccccgttgcttgcgccgcagcacttgcagccattgaagtgatggaacaagccgacctt
aagacccgcgctcaagaaatcgaggccatcatccgcgatgaattcgcgcagctgagtgcc
ttcccggaagtcgccgaaatccgcggccgcggagcaatgatggctattgagcttatcgac
gctaccggccgcccgaacgcagctttaaccgccgcagtggctgcgcgcgcaaaagctgaa
ggtgtgctgctgctgacttgcggcaccgatggcaacgtcatccgcctgctgccaccactg
gtcattgcagaggacactctccgtgatggtcttcaggtgttagtcgcagccctagagcgc
gaaaccgcgcaccagaaggtgggctaa

DBGET integrated database retrieval system