KEGG   Corynebacterium glutamicum R: cgR_0582Help
Entry
cgR_0582          CDS       T00501                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cgt00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cgt00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cgt00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:cgt00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cgt00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
642021..643367
Genome map
AA seq 448 aa AA seqDB search
MEDLSYRIPQSRTVAEQVPGPKSKALDERRQAAVARALAPGLPGYVVDADGGILADADGN
RFIDLASGIAVTTVGGSNAAVAKAVGAAAARFTHTCFMVSPYETYVAMAERLNALTPGDH
DKKSALFNSGAEAVENAVKVARAYTGKGAVVVFDNAYHGRTNLTMAMTAKNRPYKSGFGP
LAADVYRAPMSYPLRDGLSGPEAAERAISVIESQVGAENLACVVIEPIQGEGGFIVPAPG
FLAAISTWCRENDVVFIADEIQSGFLRTGDWFASDAEGVIPDVITTAKGIAGGMPLSAVT
GRAEIMDAPGPGALGGTYGGNPVACAAALAAIEVMEQADLKTRAQEIEAIIRDEFAQLSA
FPEVAEIRGRGAMMAIELIDATGRPNAALTAAVAARAKAEGVLLLTCGTDGNVIRLLPPL
VIAEDTLRDGLQVLVAALERETAHQKVG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtggaagatctctcataccgcatcccgcagtcgcgcaccgtggccgagcaggtgccaggg
ccgaagtcgaaagcgctggatgagcgtcgacaagcagcagtagcacgagcacttgcaccg
ggtctgcctggatacgtggtggacgcagacggtggcatcttggctgacgcggacggcaac
cgtttcatcgacctggcctccggcatcgccgtgaccacagtcggcggatccaacgcggcc
gtcgcgaaagccgtcggcgccgcagctgcccgcttcacccacacctgcttcatggtctca
ccttatgaaacttacgtggcaatggcggagagactcaacgccttgactccaggcgatcac
gacaagaagagcgcgctgtttaactctggcgccgaagccgtggaaaacgccgtcaaggtg
gcacgcgcctacaccggcaagggcgcggtcgtggtgttcgacaacgcgtaccacggacgg
accaacctcaccatggcgatgaccgcgaagaaccgcccatacaagtccggattcggacca
ctagccgcagacgtctaccgtgcaccaatgtcttacccactgcgcgacggactgtccggc
ccggaagccgcagagcgcgcgatctccgtgatcgaatcccaggtcggagccgaaaacctc
gcctgcgtggtcattgaaccgatccagggcgaaggcggattcatcgtccccgcaccagga
ttcctcgcagccatttccacctggtgccgcgagaacgacgtggtgttcatcgccgatgaa
atccaatctggcttcctgcgcaccggcgactggttcgccagcgacgcagaaggtgtgatc
cccgacgtcatcaccaccgcaaaaggcatcgccggcggcatgccactatccgcagtgacc
ggccgcgcagaaatcatggacgcacccggccccggcgcgctcggcggaacctacggcgga
aaccccgttgcttgcgccgcagcacttgcagccattgaagtgatggaacaagccgacctt
aagacccgcgctcaagaaatcgaggccatcatccgcgatgaattcgcgcagctgagtgcc
ttcccggaagtcgccgaaatccgcggccgcggagcaatgatggctattgagcttatcgac
gctaccggccgcccgaacgcagctttaaccgccgcagtggctgcgcgcgcaaaagctgaa
ggtgtgctgctgctgacttgcggcaccgatggcaacgtcatccgcctgctgccaccactg
gtcattgcagaggacactctccgtgatggtcttcaggtgttagtcgcagccctagagcgc
gaaaccgcgcaccagaaggtgggctaa

DBGET integrated database retrieval system