KEGG   Corynebacterium glutamicum R: cgR_0960Help
Entry
cgR_0960          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cgt00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1063801..1064559)
Genome map
AA seq 252 aa AA seqDB search
MTAQIDDSILTHRLAQGTGEILKGVRNVGVLRGRNLGDAGDELAQSWIARVLEQHRPNDG
FLSEEAADNPDRLSKDRVWIIDPLDGTKEFATGRQDWAVHIALVENGVPTHAAVGLPDLG
VVFHSADARAVTGPYSKVIAISHNRPPKVALSCAEQLGFETKALGSAGAKAMHVLLGDYD
AYIHAGGQYEWDSAAPVGVCKAAGLHCSRLDGSELTYNNKDTYMPDILICRPELADELLE
MCAKFYEENGTY
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcagattgatgattcgatcctcacccatcgtctcgcccaaggcaccggagaa
atcctcaaaggtgtccgcaatgttggggtgttaagaggtcggaatctcggtgatgccggc
gacgaactcgcacaaagttggattgctcgagtgttggagcagcaccgccccaacgatgga
ttcctgtctgaagaagccgccgacaacccagaccgcttatccaaggaccgcgtgtggatc
atcgatcccctcgacggcaccaaagaattcgccaccggccgccaggactgggcagtacac
atcgcactggtagaaaacggtgttcccacccacgccgctgttggcctccccgaccttggc
gtagtgttccactccgctgatgcccgcgccgtgactggtccttattcaaaggtcatcgcc
atctcccacaaccgcccaccaaaggttgctctatcttgcgcagagcagctcggctttgaa
accaaggcccttggatccgcaggcgctaaagcaatgcacgttctcctcggtgactacgat
gcctacatccacgccggcggccagtacgagtgggattccgcagcaccagtcggtgtctgc
aaggcagcaggcctgcactgctccaggctcgacggctccgagctgacctacaacaacaaa
gacacctacatgccagacatcttgatctgccgccctgagcttgcagatgaactcctcgag
atgtgcgcgaagttctacgaggaaaatggaacttattaa

DBGET integrated database retrieval system