KEGG   Corynebacterium glutamicum R: cgR_1012Help
Entry
cgR_1012          CDS       T00501                                 

Definition
(GenBank) hypothetical protein
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cgt  Corynebacterium glutamicum R
Pathway
cgt00900  Terpenoid backbone biosynthesis
cgt01100  Metabolic pathways
cgt01110  Biosynthesis of secondary metabolites
cgt01130  Biosynthesis of antibiotics
Module
cgt_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    cgR_1012
Enzymes [BR:cgt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     cgR_1012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: BAF53988
UniProt: A4QCP1
Position
1119072..1120010
Genome map
AA seq 312 aa AA seqDB search
MKITAKAWAKTNLHLGVGPARDDGFHELMTVFQTIDLFDTVTLTTLDEELVEEGSVVKQL
SVTGARGVPEDASNLAWRAVDALVKRRAEKTPLSAVSLHISKGIPVAGGMAGGSADAAAT
LRAVDAWIGPFGEDTLLEVAAELGSDVPFCLLGGTMRGTGRGEQLVDMLTRGKLHWVVAA
MAHGLSTPEVFKKHDELNPESHMDISDLSAALLTGNTAEVGRWLHNDLTSAALSLRPELR
SVLQEGIRSGAHAGIVSGSGPTTVFLCESEHKAQDVKEALIDAGQVYAAYTATGPAASTA
DQRGAHILTVSQ
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattaccgctaaggcgtgggcgaaaaccaatttgcatttaggtgtgggaccggct
cgcgacgatggatttcacgagctcatgacggtgtttcaaaccattgatctgtttgacacc
gtcaccttaaccaccctcgatgaggagttggtggaggaggggagcgtcgtcaagcaatta
tctgtgaccggtgcccgtggcgtgcccgaggacgccagcaatcttgcgtggcgcgctgtc
gatgcgttggttaagcggcgcgcggaaaagacgccgctgtctgcagtttcgctgcatatt
tccaaggggattccggtggctggcggcatggctggcggctctgcggatgcggctgcgacg
ctgcgcgcggtggatgcctggattgggcctttcggcgaggacacattgctggaggttgcc
gcggagctcggctcagatgtgccgttttgcctgcttggtggcaccatgcgcggtaccggt
cgcggcgagcagctggtagatatgttgacgcgcggcaagctacattgggtggtggccgcg
atggcgcatggcctatccacgcctgaggtattcaaaaagcatgatgagctgaatccggaa
tcgcatatggacatcagcgacctcagcgccgcacttctcaccggcaacaccgccgaggtg
gggcggtggctgcacaacgatctgaccagcgccgcactcagtttgcgccctgaactgcgc
agcgtcctccaagaaggcatccgctccggcgcgcacgcaggaatcgtctccggctccggc
ccgaccacggtattcttgtgcgaatcggagcacaaagcgcaagacgttaaagaggcgcta
atcgacgccggccaggtgtacgctgcttacaccgctaccggccctgcggcctcaaccgcc
gaccagcgcggcgcacacattttgactgtttcacaataa

DBGET integrated database retrieval system