KEGG   Corynebacterium glutamicum R: cgR_1192Help
Entry
cgR_1192          CDS       T00501                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cgR_1192
  Amino acid metabolism
   00300 Lysine biosynthesis
    cgR_1192
Enzymes [BR:cgt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     cgR_1192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1298219..1299328
Genome map
AA seq 369 aa AA seqDB search
MNSELKPGLDLLGDPIVLTQRLVDIPSPSGQEKQIADEIEDALRNLNLPGVEVFRFNNNV
LARTNRGLASRVMLAGHIDTVPIADNLPSRVEDGIMYGCGTVDMKSGLAVYLHTFATLAT
STELKHDLTLIAYECEEVADHLNGLGHIRDEHPEWLAADLALLGEPTGGWIEAGCQGNLR
IKVTAHGVRAHSARSWLGDNAMHKLSPIISKVAAYKAAEVNIDGLTYREGLNIVFCESGV
ANNVIPDLAWMNLNFRFAPNRDINEAIEHVVETLELDGQDGIEWAVEDGAGGALPGLGQQ
VTSGLIDAVGREKIRAKFGWTDVSRFSAMGIPALNFGAGDPSFAHKRDEQCPVEQITDVA
AILKQYLSE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgaactctgaactcaaaccaggattagatctcctcggcgacccaattgtccttactcaa
cgtttggtagatataccgagtccgtcgggtcaggaaaagcagattgctgatgaaattgaa
gatgcccttcggaaccttaatctacctggtgtagaggtcttccgcttcaacaacaacgtt
cttgctcgcacgaacaggggattggcctcgagggtcatgcttgctggtcatatcgataca
gtgccgatcgcggacaatctgccaagccgtgtggaagacggcatcatgtatggctgtggc
accgtcgatatgaaatctgggttggcggtgtatttgcatacttttgccaccttggccacg
tcgactgagcttaagcatgatctgacgctgattgcgtatgagtgcgaggaagttgctgat
cacctcaatggtttgggccacattcgcgatgagcatccggagtggttggcggctgatttg
gcgttgttgggtgagcctactggcggctggattgaggcgggctgccagggcaatctgcgc
atcaaggtgacggcgcatggtgtgcgtgcccattcggcgagaagctggttgggtgataat
gcgatgcataagttgtcgccgatcatttcgaaggttgctgcgtataaggccgcagaagtc
aacattgatggcttgacctaccgtgaaggcctcaacatcgttttctgcgaatcgggcgtg
gcaaacaacgtcattccagacctcgcgtggatgaacctcaacttccgtttcgcgccgaat
cgcgatatcaacgaggcgatcgagcatgtcgtcgaaacgcttgagcttgacgggcaagac
ggtatcgaatgggccgtagaagacggggcaggcggtgcccttccaggcttggggcagcag
gttacaagcgggcttatcgacgccgtcggccgcgaaaaaatccgcgcaaaattcggctgg
accgatgtctcacgtttttcagccatgggaattccagccctaaactttggcgctggtgat
ccaagcttcgcgcacaaacgcgacgaacagtgcccagtggagcaaatcacggatgtggca
gcaattttgaagcagtacctgagcgagtaa

DBGET integrated database retrieval system