KEGG   Corynebacterium glutamicum R: cgR_1194Help
Entry
cgR_1194          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cgt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1300182..1300799
Genome map
AA seq 205 aa AA seqDB search
MSSLPVIMAIVNRTPDSFYDKGATFEDTAALNRATEVIEQGAGIVDIGGVKAGPGDFVSA
EEEIDRVVPIIAAVRERFPDIDISVDTWRASVADVAVAHGATLINDTWAGHDHELVQVAG
QHKVGYVCSHTGGVIPRTRPYRVHFDDIVADVITETTKLAEQAVRAGVPEERVFIDPTHD
SGKTPSTDWSFYDGSMRWLPRAGRC
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagttctttgccggtcatcatggccatcgtcaaccgcaccccggattctttctatgac
aagggtgcgacatttgaggacaccgctgcgctaaacagggcaacggaggtcattgaacaa
ggcgccggcattgtcgatatcggtggggtgaaagccggcccgggggatttcgtgtcggcg
gaggaagagatcgaccgcgtggtgccaatcatcgctgcggtgcgagaacgttttcctgac
attgatatttctgttgatacctggcgggcgtcggtggctgatgtcgcagtggcgcatgga
gcaacgctgatcaatgacacttgggccggccatgatcatgagttggtgcaggtagcaggg
cagcacaaggtgggttatgtctgctcgcacaccggcggggtgattccaagaacgcgacca
tatcgggtgcatttcgatgacatcgtggccgatgtaattacggagaccaccaaattggca
gagcaagctgttcgtgccggggtgccagaggaacgggtgtttattgatcccacccatgat
tcgggaaaaacaccttccacggactggagcttttacgacggatcgatgaggtggttgcca
cgggctggccggtgctga

DBGET integrated database retrieval system