KEGG   Corynebacterium glutamicum R: cgR_1194Help
Entry
cgR_1194          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    cgR_1194
Enzymes [BR:cgt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     cgR_1194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1300182..1300799
Genome map
AA seq 205 aa AA seqDB search
MSSLPVIMAIVNRTPDSFYDKGATFEDTAALNRATEVIEQGAGIVDIGGVKAGPGDFVSA
EEEIDRVVPIIAAVRERFPDIDISVDTWRASVADVAVAHGATLINDTWAGHDHELVQVAG
QHKVGYVCSHTGGVIPRTRPYRVHFDDIVADVITETTKLAEQAVRAGVPEERVFIDPTHD
SGKTPSTDWSFYDGSMRWLPRAGRC
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagttctttgccggtcatcatggccatcgtcaaccgcaccccggattctttctatgac
aagggtgcgacatttgaggacaccgctgcgctaaacagggcaacggaggtcattgaacaa
ggcgccggcattgtcgatatcggtggggtgaaagccggcccgggggatttcgtgtcggcg
gaggaagagatcgaccgcgtggtgccaatcatcgctgcggtgcgagaacgttttcctgac
attgatatttctgttgatacctggcgggcgtcggtggctgatgtcgcagtggcgcatgga
gcaacgctgatcaatgacacttgggccggccatgatcatgagttggtgcaggtagcaggg
cagcacaaggtgggttatgtctgctcgcacaccggcggggtgattccaagaacgcgacca
tatcgggtgcatttcgatgacatcgtggccgatgtaattacggagaccaccaaattggca
gagcaagctgttcgtgccggggtgccagaggaacgggtgtttattgatcccacccatgat
tcgggaaaaacaccttccacggactggagcttttacgacggatcgatgaggtggttgcca
cgggctggccggtgctga

DBGET integrated database retrieval system