KEGG   Corynebacterium glutamicum R: cgR_1327Help
Entry
cgR_1327          CDS       T00501                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cgR_1327
   01230 Biosynthesis of amino acids
    cgR_1327
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cgR_1327
   00030 Pentose phosphate pathway
    cgR_1327
   00051 Fructose and mannose metabolism
    cgR_1327
   00052 Galactose metabolism
    cgR_1327
  Energy metabolism
   00680 Methane metabolism
    cgR_1327
Enzymes [BR:cgt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     cgR_1327
Protein phosphatases and associated proteins [BR:cgt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     cgR_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1457832..1458872
Genome map
AA seq 346 aa AA seqDB search
MEDMRIATLTSGGDCPGLNAVIRGIVRTASNEFGSTVVGYQDGWEGLLADRRVQLYDDED
IDRILLRGGTILGTGRLHPDKFKAGIDQIKANLEDAGIDALIPIGGEGTLKGAKWLSDNG
IPVVGVPKTIDNDVNGTDFTFGFDTAVAVATDAVDRLHTTAESHNRVMIVEVMGRHVGWI
ALHAGMAGGAHYTVIPEVPFDIAEICKAMERRFQMGEKYGIIVVAEGALPREGTMELREG
HIDQFGHKTFTGIGQQIADEIHARLGHDVRTTVLGHIQRGGTPTAFDRVLATRYGVRAAR
ACHEGSFDKVVALKGERIEMITFEDAVGTLKEVPFERWVTAQAMFG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaagacatgcgaattgctactctcacgtcaggcggcgactgccccggactaaacgcc
gtcatccgaggaatcgtccgcacagccagcaatgaatttggctccaccgtcgttggttat
caagacggttgggaaggactgttagccgatcgtcgcgtacagctgtatgacgatgaagat
attgaccgaatcctccttcgaggcggcaccattttgggcactggtcgcctccatccggac
aagtttaaggccggaattgatcagattaaggccaacttagaagacgccggcatcgatgcc
cttattccaatcggtggcgaaggaaccctgaagggtgccaagtggctgtctgataacggt
atccctgttgtcggtgtcccaaagaccattgacaatgacgtgaatggcactgacttcacc
ttcggtttcgatactgctgttgcagtggctaccgacgctgttgaccgcctgcacaccacc
gctgaatctcacaaccgtgtgatgattgtggaggtcatgggccgccacgtgggttggatt
gctctgcacgcaggtatggccggcggtgctcactacaccgttatcccagaagttcctttc
gatattgcagagatctgcaaggcgatggaacgtcgcttccagatgggcgagaagtacggc
attatcgtcgttgcggaaggtgcattgccacgcgaaggcaccatggaacttcgtgaaggc
cacattgaccagttcggccacaagaccttcaccggaatcggccagcagattgctgatgaa
atccatgcgcgcctcggtcacgatgttcgtaccaccgttcttggccacattcagcgtggt
ggaaccccgactgctttcgaccgtgttctggccactcgttatggtgttcgggcagctcgt
gcatgccatgagggaagctttgacaaggttgttgccttgaagggtgagcgcatcgagatg
atcacctttgaagatgccgtcggaaccttgaaggaagttccattcgagcgctgggttact
gcccaggcaatgtttggatag

DBGET integrated database retrieval system