KEGG   Corynebacterium glutamicum R: cgR_1634Help
Entry
cgR_1634          CDS       T00501                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cgR_1634 (tpiA)
   01230 Biosynthesis of amino acids
    cgR_1634 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cgR_1634 (tpiA)
   00051 Fructose and mannose metabolism
    cgR_1634 (tpiA)
   00562 Inositol phosphate metabolism
    cgR_1634 (tpiA)
Enzymes [BR:cgt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     cgR_1634 (tpiA)
Exosome [BR:cgt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   cgR_1634 (tpiA)
  Exosomal proteins of bladder cancer cells
   cgR_1634 (tpiA)
  Exosomal proteins of melanoma cells
   cgR_1634 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1818516..1819295)
Genome map
AA seq 259 aa AA seqDB search
MARKPLIAGNWKMNLDHQQAIGTVQKLAFALPKEYFEKVDVAVTVPFTDIRSVQTLVEGD
KLEVTFGAQDVSQHESGAYTGEVSASMLAKLNCSWVVVGHSERREYHNESDELVAAKAKA
ALSNGISPIVCVGEPLEIREAGTHVEYVVEQTRKSLAGLDATELANTVIAYEPVWAIGTG
KVASAADAQEVCKAIRGLIVELAGDEVAEGLRILYGGSVKAETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAASVA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaagccacttatcgctggtaactggaagatgaacctggatcaccagcaggca
atcggcactgttcagaagcttgcattcgcccttccaaaggaatacttcgagaaggttgac
gttgcagtcaccgttcctttcactgacatccgctccgtccagactctcgttgagggcgac
aagcttgaggtcactttcggtgctcaggacgtctcccagcacgagtccggtgcgtacacc
ggtgaagtttctgcaagcatgcttgcaaagctgaactgctcttgggttgtcgttggacac
tccgagcgccgcgagtaccacaacgagtctgatgagttggttgctgcgaaggcaaaggca
gctctgtccaacggcatcagcccgatcgtctgcgttggtgagccactggaaatccgcgaa
gctggcacccacgttgagtacgtcgtcgagcagacccgcaagtcacttgctggcctggac
gctactgagctggccaacaccgttatcgcgtatgagccagtgtgggctatcggcactggc
aaggttgcttccgcagctgacgctcaggaagtgtgcaaggctatccgcggtctgatcgtg
gagcttgcaggtgacgaggtcgctgaaggcctgcgcattctttacggtggttctgttaag
gcagaaaccgtcgctgagatcgtcggacagcctgacgtcgacggcggacttgtcggtggc
gcttccctcgacggtgaagcattcgccaagctggctgccaacgctgcgagcgtcgcttaa

DBGET integrated database retrieval system