KEGG   Corynebacterium glutamicum R: cgR_1739Help
Entry
cgR_1739          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cgR_1739
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cgR_1739
   00520 Amino sugar and nucleotide sugar metabolism
    cgR_1739
Enzymes [BR:cgt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     cgR_1739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1929271..1930503
Genome map
AA seq 410 aa AA seqDB search
MARGGVQHPGDHIDHSTCYDLAVDRRSDRDGVLGQAIKEVDGAVNGVDDPGNSAYRRRPR
PFLAYQPVFRPKFLQPIGDKIFSQSIYYRHRIDCRTFGVGVVPQIGEFSTFIPDTCSGKR
GSFRGDGTQLIKRLLFHKTIIVVFLENCLPKAEVICTLGRMTETGFGIDIGGSGIKGARV
NLKTGEFIDERIKIATPKPATPEAVAEVVAEIISQAEWEGPVGITLPSVVRGQIALSAAN
IDKSWIGTDVHELFDRHLNGREITVLNDADAAGIAEATFGNAAAREGAVILLTLGTGIGS
AFLVDGQLFPNTELGHMIVDGEEAEHLAAAAVKENEDLSWKKWAKRLNKVLSEYEKLFSP
SVFIIGGGISRKHEKWLPLLELDTDIVPAELRNRAGIVGAAMAVNQHLTP
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgcggcggtgtacagcaccccggtgaccacattgatcacagcacctgctacgac
ctcgccgtcgatcgccgcagcgatcgagacggcgtattggggcaggccataaaggaagtt
gacggtgccgtcaatggggtcgacgatccaggtaactccgcttatcgacgccgtccccgt
cccttcctcgcctatcagcccgtctttaggccgaagttcctgcaacctattggcgataaa
atcttcagccaaagtatctactatcgtcaccggatcgactgtcgaacttttggtgttggt
gtagtcccacaaattggtgagttcagcacgtttatccctgatacgtgtagcggtaagcgt
ggcagtttccgcggcgatggcacgcaactcattaaacgattgttgttccataagaccatc
atcgttgtttttttagaaaattgcctgccaaaagccgaagtaatttgtacacttgggcgc
atgactgagactggatttggaattgatatcggtggctccggcatcaaaggcgcccgcgtt
aaccttaagaccggtgagtttattgatgaacgcataaaaatcgccacccctaagccagca
accccagaggctgtcgccgaagtagtcgcagagattatttctcaagccgaatgggagggt
ccggtcggaattaccctgccgtctgtcgttcgcgggcagatcgcgctatccgcagccaac
attgacaagtcctggatcggcaccgatgtgcacgaactttttgaccgccacctaaatggc
cgagagatcaccgttctcaatgacgcagacgccgccggcatcgccgaagcaacctttggc
aacgctgccgcacgcgaaggcgcagtcatcctgctgacccttggtacaggtattggatcc
gcattccttgtggatggccaactgttccccaacacagaactcggtcacatgatcgttgac
ggcgaggaagcagaacaccttgcagcagcagccgtcaaagaaaacgaagatctgtcatgg
aagaaatgggcgaagcgcctgaacaaggtgctgagcgaatacgagaaacttttctcccca
tccgtcttcatcatcggtggcggaatttccagaaagcacgaaaagtggcttccattgctg
gagctagacactgacattgtcccagctgagctgcgcaatcgagccggaatcgtaggagct
gccatggcagtaaaccaacacctcaccccataa

DBGET integrated database retrieval system