KEGG   Corynebacterium glutamicum R: cgR_1826Help
Entry
cgR_1826          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cgt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2028177..2029280)
Genome map
AA seq 367 aa AA seqDB search
MASQQIRYPFSAVVGQDELRLALILTAISPRIGGVVIRGEKGTAKTTTVRAFAGLLGDAP
LVNLPLGSTEDRVVGSLNMETVLTTGRAEYQPGLLAQADGGVLYVDEVNLLADHLVDALL
DAAASGRVSIERDGISHSSPANFVLVGTMNPEEGELRPQLLDRFGLAVDVAASTNPEVRV
EIIRRRLDFENAPEQFMAKWAEQDADTSNRILAAKDLLPGVELPDLILSQIAWLCARIEV
DGMRADLVITRTALAHAAWAGRTVVTEEDVEIAARLALPHRRRRNPFDAPEMEERKLQET
LQEARDFFKDNEDKGPAAKITDEETGAEAFTDTDNPTEEDGLQGTAQAKAQTTGKVGTAG
SGDPFRS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacaacagatccgctatccattctccgcagttgtgggacaagacgagcttcgg
cttgcgttgatcctcactgcgatttccccacgcattggtggcgtggtgattcgaggtgag
aagggtacagcgaaaactaccactgtgcgtgcttttgctggtcttttaggtgatgcccct
ttggtgaacttgcctctcggatccacggaggatcgtgtggtgggttccctcaacatggaa
actgtgttgaccaccggccgtgcggaatatcagccaggtttgctcgcgcaggctgatggc
ggtgtgctgtatgtcgatgaggtcaacctcttggcggatcacctggtggatgctctgctc
gatgcagctgcaagcggtcgcgtcagcattgagcgtgacggtatttcgcattcttcacca
gcaaactttgtgttggtgggcaccatgaatccggaggaaggcgaactgcgcccgcagctg
ctggaccgtttcggtttggctgtggatgttgctgcctccactaaccctgaggtgcgcgtg
gagatcattcgccgccggcttgattttgaaaacgctcctgagcagttcatggctaagtgg
gctgagcaagatgcggacacctccaaccgtattttggcggctaaggatttgctgcctggt
gtggagttgccggatctgatcttgtcgcagattgcgtggttgtgtgcacgtattgaggtc
gacggtatgcgcgctgacctggtgatcacgcgtaccgcacttgctcacgccgcgtgggct
ggacgcactgtggttacggaagaagacgtggagatcgcagctcgcctggcgttgccgcac
cgccgtcgccgtaatccttttgatgctccagaaatggaggagcgcaagcttcaggaaacc
ctgcaggaagctcgggacttcttcaaagacaatgaggacaagggacctgctgccaagatc
acggatgaggaaaccggggcagaggccttcaccgataccgacaatcccaccgaggaagac
ggtttgcagggaactgcgcaggcgaaggcgcagactactggaaaggtaggtactgccgga
tccggcgacccctttcgctcctag

DBGET integrated database retrieval system