KEGG   Corynebacterium glutamicum R: cgR_1975Help
Entry
cgR_1975          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cgR_1975
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cgR_1975
Enzymes [BR:cgt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     cgR_1975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2174037..2174822)
Genome map
AA seq 261 aa AA seqDB search
MVATENRMLMEIAAEISTREATLGFQEVKTKSRSAGLTAAFDIASVFFSSGCNVVVAFDR
FASNWSDHSDHVDYAAQVAGFGASMLAYTVRRGQFDTAVRDIRDIKSEVDIPILLHDPII
DPYQIHEARVMGIDALQFPVWAMEQARLESLVDRTESLGMTAIVSVRNHEEAHRAVDAGA
TVVAIDITGYTGSLTLPEAFSGITQFMPKEVARIVLGGCSSPKELMRFARHSADAIFVPH
ADLATTKSLVTAGMHPACPSR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaacagagaaccgcatgttgatggaaatcgctgcggaaatatcgactcgggaa
gcaacgcttggttttcaagaagtcaaaactaaatctcgatcagcaggtctcacggcggct
ttcgatatcgcttcagtctttttttcgtctggatgtaatgtcgtagtcgcctttgatcgt
tttgcatccaattggtctgatcattcggatcatgtggactacgctgcacaggttgcgggt
tttggcgcatcaatgcttgcatatacggtgcgcaggggacagtttgataccgcagtacgc
gatatcagggacatcaaatctgaagtagacattcccattctgcttcatgatcccatcatc
gatccgtatcaaattcacgaagcccgcgtcatgggcatcgacgctcttcaattccccgta
tgggcgatggaacaagctcgactggaatctttggtggaccgcaccgaatcattgggcatg
acagccatcgtgtctgtgcgaaaccacgaagaagcgcatcgtgctgtggacgcaggagcg
acagtggtagcaattgatattactggttataccggctcactcactttgcctgaagcgttt
tcgggtatcacccaattcatgcccaaagaggtagcccgcattgtgctcggaggttgcagc
agccctaaagaactcatgcggtttgcacgacattctgcagacgccatctttgttccacat
gcagacctggccaccacaaaatctcttgtgacagcaggtatgcatccagcgtgcccatcg
cgttga

DBGET integrated database retrieval system