KEGG   Corynebacterium glutamicum R: cgR_2002Help
Entry
cgR_2002          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K06044  
(1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase [EC:5.4.99.15]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    cgR_2002
Enzymes [BR:cgt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.15  (1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase
     cgR_2002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2200539..2202974
Genome map
AA seq 811 aa AA seqDB search
MARPISATYRLQMRGPQADSAGRSFGFAQAKAQLPYLKKLGISHLYLSPIFTAMPDSNHG
YDVIDPTTINEELGGMEGLRDLAAAAHELGMGIIIDIVPNHLGVAVPHLNPWWWDVLKNG
KDSAFEFYFDIDWHEDNGSGGKLGMPILGAEGDEDKLEFAELDGEKVLKYFDHLFPIAPG
TEEGTPQEVYKRQHYRLQFWRDGVINFRRFFSVNTLAGIRQEDPLVFEHTHRLLRELVAE
DLIDGVRVDHPDGLSDPFGYLHRLRDLIGPDRWLIIEKILSVDEPLDPRLAVDGTTGYDA
LRELDGVFISRESEDKFSMLALTHSGSTWDERALKSTEESLKRVVAQQELAAEILRLARA
MRRDNFSTAGTNVTEDKLSETIIELVAAMPVYRADYISLSRTTATVIAEMSKRFPSRRDA
LDLIAAALLGNGEAKIRFAQVCGAVMAKGVEDTTFYRASRLVALQEVGGAPGRFGVSAAE
FHLLQEERSLLWPRTMTTLSTHDTKRGEDTRARIISLSEVPDMYSELVNRVFAVLPAPDG
ATGSFLLQNLLGVWPADGVITDALRDRFREYALKAIREASTKTTWVDPNESFEAAVCDWV
EALFDGPSTSLITEFVSHINRGSVQISLGRKLLQMVGAGIPDTYQGTEFLEDSLVDPDNR
RFVDYTAREQVLERLQTWDWTQVNSVEDLVDNADIAKMAVVHKSLELRAEFRASFVGGDH
QAVFGEGRAESHIMGIARGTDRNHLNIIALATRRPLILEDRGGWYDTTVTLPGGQWEDRL
TGQRFSGVVPATDLFSHLPVSLLVLVPDSEF
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtccaatttccgcaacgtacaggcttcaaatgcgaggacctcaagcagatagc
gccgggcgttcatttggttttgcgcaggccaaagcccagcttccctatctgaagaagcta
ggcatcagccacctgtacctctcccctatttttacggccatgccagattccaatcatggc
tacgatgtcattgatcccaccaccatcaatgaagagctcggtggcatggagggtcttcga
gatcttgccgcagcggctcacgagttgggcatgggcatcatcattgatattgttcccaac
catttaggtgttgccgttccgcatttgaatccttggtggtgggatgttctaaaaaacggc
aaagattccgcttttgagttctatttcgatattgattggcacgaagacaacggttctggt
ggcaagctgggcatgccgattctgggtgctgaaggcgatgaagacaagctggaattcgcg
gagcttgatggagagaaagtgctcaaatattttgaccacctcttcccaatcgcgcctggt
accgaagaagggacaccgcaagaagtctacaagcgccagcattaccgcctgcagttctgg
cgcgacggcgtgatcaacttccgtcgcttcttttccgtgaatacgttggctggcatcagg
caagaagatcccttggtgtttgaacatactcatcgtctgctgcgcgaattggtggcggaa
gacctcattgacggcgtgcgcgtcgatcaccccgacgggctttccgatccttttggatat
ctgcacagactccgcgacctcattggacctgaccgctggctgatcatcgaaaagatcttg
agcgttgatgaaccactcgatccccgcctggccgttgatggcaccactggctacgacgcc
ctccgtgaactcgacggcgtgtttatctcccgagaatctgaggacaaattctccatgctg
gcgctgacccacagtggatccacctgggatgaacgcgccctcaaatccacggaggaaagc
ctcaaacgagtcgtcgcccaacaagaactcgcagccgaaatcttaaggctcgcccgcgcc
atgcgccgcgacaacttctccaccgcaggcaccaacgtcaccgaagacaaacttagcgaa
accatcatcgaattagtcgccgccatgcccgtctaccgcgccgactacatctccctctca
cgcaccaccgccaccgtcatcgcggagatgtccaaacgcttcccctcccggcgtgacgca
ctcgacctcatcgcggccgccctacttggcaatggcgaggccaaaatccgcttcgctcaa
gtctgcggcgccgtcatggctaaaggtgtggaagacaccaccttctaccgcgcatctagg
ctcgttgcattgcaagaagtcggtggcgcgccggggagattcggcgtctccgctgcagaa
ttccacttgctgcaggaagaacgcagcctgctgtggccacgcaccatgaccaccttgtcc
acgcatgacaccaaacgtggcgaagatacccgcgcccgcatcatctccctgtctgaagtc
cccgatatgtactccgagctggtcaatcgtgttttcgcggtgctccccgcgccagacggc
gcaacgggcagtttcctcctacaaaacctgctgggcgtatggcccgccgacggcgtgatc
accgatgcgctgcgcgatcgattcagggaatacgccctaaaagctatccgcgaagcatcc
acaaaaaccacgtgggtggaccccaacgagtccttcgaggctgcggtctgcgattgggtg
gaagcgcttttcgacggaccctccacctcattaatcaccgaatttgtctcccacatcaac
cgtggctctgttcaaatctccttaggcaggaaactgctgcaaatggtgggcgctggaatc
cccgacacttaccaaggaactgagtttttagaagactccctggtagatcccgataaccga
cgctttgttgattacaccgccagagaacaagtcctggagcgcctgcaaacctgggattgg
acgcaggttaattcggtagaagacttggtggataacgccgacatcgccaaaatggccgtg
gtccataaatccctcgagttgcgtgctgaatttcgtgcaagctttgttggtggagatcat
caggcagtatttggcgaaggtcgcgcagaatcccacatcatgggcatcgcccgcggtaca
gaccgaaaccacctcaacatcattgctcttgctacccgtcgaccactgatcttggaagac
cgtggcggatggtatgacaccaccgtcacgcttcctggtggacaatgggaagacaggctc
accgggcaacgcttcagtggtgttgtcccagccaccgatttgttctcacatctacccgta
tctttgttggttttagtacccgatagtgagttttga

DBGET integrated database retrieval system