KEGG   Corynebacterium glutamicum R: cgR_2067Help
Entry
cgR_2067          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cgR_2067
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cgR_2067
   00052 Galactose metabolism
    cgR_2067
   00500 Starch and sucrose metabolism
    cgR_2067
   00520 Amino sugar and nucleotide sugar metabolism
    cgR_2067
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    cgR_2067
   00524 Butirosin and neomycin biosynthesis
    cgR_2067
Enzymes [BR:cgt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     cgR_2067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2280584..2281555)
Genome map
AA seq 323 aa AA seqDB search
MPQKPASFAVGFDIGGTNMRAGLVDESGRIVTSLSAPSPRTTQAMEQGIFDLVEQLKAEY
PVGAVGLAVAGFLDPECEVVRFAPHLPWRDEPVREKLENLLGLPVRLEHDANSAAWGEHR
FGAAQGADNWVLLALGTGIGAALIEKGEIYRGAYGTAPEFGHLRVVRGGRACACGKEGCL
ERYCSGTALVYTARELASHGSFRNSGLFDKIKADPNSINGKTITAAARQEDPLALAVLED
FSEWLGETLAIIADVLDPGMIIIGGGLSNAADLYLDRSVNHYSTRIVGAGYRPLARVATA
QLGADAGMIGVADLARRSVLEAN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgccacaaaaaccggccagtttcgcggtgggctttgacatcggcggcaccaacatgcga
gctgggcttgtcgacgaatccgggcgcatcgtgaccagtttgtcggcgccgtcgccgcgc
acgacgcaggcaatggaacaggggatttttgatctagtcgaacagctcaaggccgaatac
ccggttggtgctgtgggacttgccgtcgcgggatttttggatcctgagtgcgaggttgtt
cgatttgccccgcaccttccttggcgcgatgagccagtgcgtgaaaagttggaaaacctt
ttgggcctgcctgttcgtttggaacatgatgccaactcagcagcgtggggtgagcatcgt
tttggtgcagctcaaggcgctgacaactgggttttgttggcactcggcactggaattggt
gcagcgctgattgaaaaaggcgaaatttaccgtggtgcatatggcacggcaccagaattt
ggtcatttgcgtgttgttcgtggcggacgcgcatgtgcgtgtggcaaagaaggctgcctg
gagcgttactgttccggtactgccttggtttacactgcgcgtgaattggcttcgcatggc
tcattccgcaacagcgggctgtttgacaagatcaaagccgatccgaattccatcaatgga
aaaacgatcactgcggcagcgcgccaagaagacccacttgctctcgccgttctggaagat
ttcagcgagtggctgggcgaaactttggcgatcattgctgatgtccttgacccaggtatg
atcatcattggtggcggactgtccaatgctgccgacctttatttggatcgctcggttaac
cactattccacccgcatcgtcggcgcaggatatcgccctttggcacgcgttgccacagct
cagttgggtgcggatgctggcatgatcggtgtcgctgatctggctcgacgttccgtgttg
gaagccaactag

DBGET integrated database retrieval system