KEGG   Corynebacterium glutamicum R: cgR_2077Help
Entry
cgR_2077          CDS       T00501                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    cgR_2077
Enzymes [BR:cgt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     cgR_2077
Peptidases [BR:cgt01002]
 Cysteine Peptidases
  Family C44
   cgR_2077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2292526..2294448
Genome map
AA seq 640 aa AA seqDB search
MCGLLGILTANGNAEAFVPALERALPCMRHRGPDDAGTWHDADAAFGFNRLSIIDIAHSH
QPLRWGPADEPDRYAMTFNGEIYNYVELRKELSDLGYTFNTSGDGEPIVVGFHHWGESVV
EHLRGMFGIAIWDTKEKSLFLARDQFGIKPLFYATTEHGTVFSSEKKTILEMAEEMNLDL
GLDKRTIEHYVDLQYVPEPDTLHAQISRLESGCTATVRPGGKLEQKRYFKPQFPVQKVVK
GKEQDLFDRIAQVLEDSVEKHMRADVTVGSFLSGGIDSTAIAALAKRHNPDLLTFTTGFE
REGYSEVDVAAESAAAIGAEHIVKIVSPEEYANAIPKIMWYLDDPVADPSLVPLYFVAAE
ARKHVKVVLSGEGADELFGGYTIYKEPLSLAPFEKIPSPLRKGLGKLSKVLPDGMKGKSL
LERGSMTMEERYYGNARSFNFEQMQRVIPWAKREWDHREVTAPIYAQSRNFDPVARMQHL
DLFTWMRGDILVKADKINMANSLELRVPFLDKEVFKVAETIPYDLKIANGTTKYALRRAL
EQIVPPHVLHRKKLGFPVPMRHWLAGDELFGWAQDTIKESGTEDIFNKQAVLDMLNEHRD
GVSDHSRRLWTVLSFMVWHGIFVENRIDPQIEDRSYPVEL
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggccttcttggcatattgactgcaaatgggaacgctgaagcattcgttcctgca
ctcgagcgggccttgccatgcatgcgccaccgtggtcctgacgatgccggcacttggcat
gacgccgatgcagcgtttggattcaaccgcctctccatcattgatattgcacactcccac
caaccactgcgttggggacctgcggatgaacccgaccgctacgcaatgactttcaacggt
gagatctacaactacgttgagctgcgtaaagagctctcggatttgggatatacctttaat
acttctggcgatggcgagccaattgttgtcggtttccaccactggggcgagtccgtggtc
gagcatctccgcggaatgttcggcattgccatttgggatacaaaggaaaagtcgcttttc
cttgcgcgtgatcagttcggcatcaagccactgttctacgcaaccaccgagcatggcacc
gtgttctcctcagagaagaagactatcttggagatggccgaggagatgaatctagatttg
ggccttgataaacgcaccattgagcactacgtggacttgcagtacgtgcccgagccagat
acccttcacgcgcagatttcccgcttggagtcaggctgcaccgcaacagttcgtccgggc
ggcaagctggaacagaagcgttacttcaagcctcagttcccagtacagaaggtcgtaaag
ggtaaggagcaggacctcttcgatcgcattgcccaggtgttggaggatagcgtcgaaaag
catatgcgtgccgacgtgaccgtaggctcgttcctttccggcggcattgactcaaccgca
attgcggcgcttgcaaagcgccacaaccctgacctgctcaccttcaccaccggtttcgag
cgtgaaggctactcggaggtcgatgtggctgcggagtccgccgctgcgattggcgctgag
cacatcgtgaagattgtctcgcctgaggaatacgccaacgcgattcctaagatcatgtgg
tacttggatgatcctgtagctgacccatcattggtcccgctgtacttcgtggcagcggaa
gcacgtaagcacgtcaaggttgtgctgtctggcgagggcgcagatgagctgttcggtgga
tacaccatttacaaggagccgctatcgcttgctccatttgagaagatcccttccccacta
cgtaaaggcctgggaaagctcagcaaggttctgccagacggcatgaagggcaagtccctt
cttgagcgtggctccatgaccatggaagagcgctactacggcaacgctcgctccttcaat
ttcgagcagatgcaacgcgttattccatgggcaaagcgcgaatgggaccaccgcgaggtc
actgcaccgatctacgcacagtcccgcaactttgatccagtagcccgcatgcaacacctg
gatctgttcacctggatgcgcggcgacatcctggtcaaggctgacaagatcaacatggcg
aactcccttgagctgcgagttccattcttggataaggaagttttcaaggttgcagagacc
attccttacgatctgaagattgccaacggtaccaccaagtacgcgctgcgcagggcactc
gagcagattgttccgcctcacgttttgcaccgcaagaagctgggcttccctgttcccatg
cgccactggcttgccggcgatgagctgttcggttgggcgcaggacaccatcaaggaatcc
ggtactgaagatatcttcaacaagcaggctgtgctggatatgctgaacgagcaccgcgat
ggcgtgtcagatcattcccgtcgactgtggactgttctgtcatttatggtgtggcacggc
atttttgtggaaaaccgcattgatccacagattgaggaccgctcctacccagtcgagctt
taa

DBGET integrated database retrieval system