KEGG   Corynebacterium glutamicum R: cgR_2087Help
Entry
cgR_2087          CDS       T00501                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cgt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cgR_2087 (aceF)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    cgR_2087 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    cgR_2087 (aceF)
Enzymes [BR:cgt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     cgR_2087 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2303279..2305312
Genome map
AA seq 677 aa AA seqDB search
MAFSVEMPELGESVTEGTITQWLKSVGDTVEVDEPLLEVSTDKVDTEIPSPVAGVILEIK
AEEDDTVDVGGVIAIIGDADETPANEAPADEAPAPAEEEEPVKEEPKKEAAPEAPAATGA
ATDVEMPELGESVTEGTITQWLKAVGDTVEVDEPLLEVSTDKVDTEIPSPVAGTIVEILA
DEDDTVDVGAVIARIGDANAAAAPAEEEAAPAEEEAAPAEEEEPVKEEPKKEAAPEAPAA
TGAATDVEMPELGESVTEGTITQWLKAVGDTVEVDEPLLEVSTDKVDTEIPSPVAGTIVE
ILADEDDTVDVGAVIARIGDANAAAAPAEEEAAPAEEEDPVKEEPKKEEPKKEAATTPAA
ASATVSASGDNVPYVTPLVRKLAEKHGVDLNTVTGTGIGGRIRKQDVLAAANDEAAPAEA
AAPVSAWSTKSVDPEKAKLRGTTQKVNRIREITAKKTVEALQISAQLTQLHEVDMTRVAE
LRKKNKPAFIEKHGVNLTYLPFFVKAVVEALVSHPNVNASYNAKTKEMTYHSSVNLSIAV
DTPAGLLTPVIHDAQDLSIPEIAKAIVDLADRSRNNKLKPNDLSGGTFTITNIGSEGALS
DTPILVPPQAGILGTGAIVKRPVVITEDGIDSIAIRQMVFLPLTYDHQVVDGADAGRFLT
TIKDRLETANFEGDLQL
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctccgtagagatgcccgagctgggcgaatcagtaaccgaaggcacgatcacc
cagtggttgaagtctgttggtgacactgttgaggtagatgagccgttgctcgaggtctca
actgacaaggtcgacaccgagattccctctcctgtcgccggtgtcatcctagagattaag
gctgaagaggatgacaccgtcgacgtcggcggggtcattgcaataatcggcgatgctgat
gagactcctgccaacgaagctcctgccgacgaggcaccagcacctgccgaagaggaagaa
ccagttaaggaagagccaaagaaggaggcagctcctgaagctccagcagcaactggcgca
gcaaccgatgtggaaatgccagaactcggcgagtccgtcaccgaaggcaccattacccag
tggctcaaggctgtcggcgacaccgtcgaagtagacgaaccacttcttgaggtctccacc
gacaaggtcgacaccgaaatcccatccccagtagcaggcaccatcgtggagatccttgcg
gacgaagacgacaccgtcgacgtcggcgcagtcatcgcccgcatcggtgacgcaaacgca
gctgcagcacctgccgaagaggaagcagcacctgccgaagaggaagcagcacctgccgaa
gaggaagaaccagttaaggaagagccaaagaaggaggcagctcctgaagctccagcagca
actggcgcagcaaccgatgtggaaatgccagaactcggcgaatccgtcaccgaaggcacc
attacccagtggctcaaggctgtcggcgacaccgtcgaagtagacgaaccacttcttgag
gtctccaccgacaaggtcgacaccgaaatcccatccccagtagcaggcaccatcgtggag
atccttgcagacgaagacgacaccgtcgacgtcggcgcagtcatcgcccgcatcggtgac
gcaaacgcagctgcagcacctgccgaagaggaagcagctcctgccgaagaggaagaccca
gttaaggaagagccaaagaaggaagagcccaagaaggaagcagctactacacctgctgcg
gcatccgcaactgtgtccgcttctggcgacaacgttccatacgtcaccccactggtgcgc
aagcttgctgaaaagcacggcgttgacttgaacaccgtgaccggtaccggtatcggtggc
cgtatccgcaagcaggatgttttggctgctgcgaacgacgaggctgcacctgctgaggct
gctgctcctgtttccgcttggtccactaagtctgttgatcctgagaaggctaagctccgt
ggtaccactcagaaggtcaaccgcatccgtgagatcaccgcgaagaagaccgtcgaggct
ctgcagatttctgctcagctcacccagctgcacgaggtcgatatgactcgcgttgctgag
ctgcgtaagaagaacaagcccgcgttcatcgagaagcacggtgtgaacctcacttacctg
ccattcttcgtgaaggcagttgtcgaggctttggtttcccatccaaacgtcaacgcgtct
tacaacgcgaagaccaaggagatgacctaccactcctccgttaacctctccatcgctgtt
gataccccagctggtctgttgaccccagtcattcacgatgctcaggatctctccatccca
gagatcgcaaaggcaattgttgacctggctgatcgttcacgcaacaacaagctgaagcca
aacgatctgtccggtggcaccttcaccatcaccaacattggttctgaaggcgcactgtct
gataccccaatcctggttccgccacaggctggcatcttgggcaccggcgcgatcgtgaag
cgtccagttgtcatcaccgaggatggaattgattccatcgcgatccgtcagatggtcttc
ctgccactgacctacgatcaccaggttgtagatggcgcagatgctggtcgcttcctgacc
accatcaaggaccgccttgagaccgctaacttcgaaggcgatctgcagctctaa

DBGET integrated database retrieval system