KEGG   Corynebacterium glutamicum R: cgR_2087Help
Entry
cgR_2087          CDS       T00501                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cgt  Corynebacterium glutamicum R
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cgt01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cgt00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cgt00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2303279..2305312
Genome map
AA seq 677 aa AA seqDB search
MAFSVEMPELGESVTEGTITQWLKSVGDTVEVDEPLLEVSTDKVDTEIPSPVAGVILEIK
AEEDDTVDVGGVIAIIGDADETPANEAPADEAPAPAEEEEPVKEEPKKEAAPEAPAATGA
ATDVEMPELGESVTEGTITQWLKAVGDTVEVDEPLLEVSTDKVDTEIPSPVAGTIVEILA
DEDDTVDVGAVIARIGDANAAAAPAEEEAAPAEEEAAPAEEEEPVKEEPKKEAAPEAPAA
TGAATDVEMPELGESVTEGTITQWLKAVGDTVEVDEPLLEVSTDKVDTEIPSPVAGTIVE
ILADEDDTVDVGAVIARIGDANAAAAPAEEEAAPAEEEDPVKEEPKKEEPKKEAATTPAA
ASATVSASGDNVPYVTPLVRKLAEKHGVDLNTVTGTGIGGRIRKQDVLAAANDEAAPAEA
AAPVSAWSTKSVDPEKAKLRGTTQKVNRIREITAKKTVEALQISAQLTQLHEVDMTRVAE
LRKKNKPAFIEKHGVNLTYLPFFVKAVVEALVSHPNVNASYNAKTKEMTYHSSVNLSIAV
DTPAGLLTPVIHDAQDLSIPEIAKAIVDLADRSRNNKLKPNDLSGGTFTITNIGSEGALS
DTPILVPPQAGILGTGAIVKRPVVITEDGIDSIAIRQMVFLPLTYDHQVVDGADAGRFLT
TIKDRLETANFEGDLQL
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctccgtagagatgcccgagctgggcgaatcagtaaccgaaggcacgatcacc
cagtggttgaagtctgttggtgacactgttgaggtagatgagccgttgctcgaggtctca
actgacaaggtcgacaccgagattccctctcctgtcgccggtgtcatcctagagattaag
gctgaagaggatgacaccgtcgacgtcggcggggtcattgcaataatcggcgatgctgat
gagactcctgccaacgaagctcctgccgacgaggcaccagcacctgccgaagaggaagaa
ccagttaaggaagagccaaagaaggaggcagctcctgaagctccagcagcaactggcgca
gcaaccgatgtggaaatgccagaactcggcgagtccgtcaccgaaggcaccattacccag
tggctcaaggctgtcggcgacaccgtcgaagtagacgaaccacttcttgaggtctccacc
gacaaggtcgacaccgaaatcccatccccagtagcaggcaccatcgtggagatccttgcg
gacgaagacgacaccgtcgacgtcggcgcagtcatcgcccgcatcggtgacgcaaacgca
gctgcagcacctgccgaagaggaagcagcacctgccgaagaggaagcagcacctgccgaa
gaggaagaaccagttaaggaagagccaaagaaggaggcagctcctgaagctccagcagca
actggcgcagcaaccgatgtggaaatgccagaactcggcgaatccgtcaccgaaggcacc
attacccagtggctcaaggctgtcggcgacaccgtcgaagtagacgaaccacttcttgag
gtctccaccgacaaggtcgacaccgaaatcccatccccagtagcaggcaccatcgtggag
atccttgcagacgaagacgacaccgtcgacgtcggcgcagtcatcgcccgcatcggtgac
gcaaacgcagctgcagcacctgccgaagaggaagcagctcctgccgaagaggaagaccca
gttaaggaagagccaaagaaggaagagcccaagaaggaagcagctactacacctgctgcg
gcatccgcaactgtgtccgcttctggcgacaacgttccatacgtcaccccactggtgcgc
aagcttgctgaaaagcacggcgttgacttgaacaccgtgaccggtaccggtatcggtggc
cgtatccgcaagcaggatgttttggctgctgcgaacgacgaggctgcacctgctgaggct
gctgctcctgtttccgcttggtccactaagtctgttgatcctgagaaggctaagctccgt
ggtaccactcagaaggtcaaccgcatccgtgagatcaccgcgaagaagaccgtcgaggct
ctgcagatttctgctcagctcacccagctgcacgaggtcgatatgactcgcgttgctgag
ctgcgtaagaagaacaagcccgcgttcatcgagaagcacggtgtgaacctcacttacctg
ccattcttcgtgaaggcagttgtcgaggctttggtttcccatccaaacgtcaacgcgtct
tacaacgcgaagaccaaggagatgacctaccactcctccgttaacctctccatcgctgtt
gataccccagctggtctgttgaccccagtcattcacgatgctcaggatctctccatccca
gagatcgcaaaggcaattgttgacctggctgatcgttcacgcaacaacaagctgaagcca
aacgatctgtccggtggcaccttcaccatcaccaacattggttctgaaggcgcactgtct
gataccccaatcctggttccgccacaggctggcatcttgggcaccggcgcgatcgtgaag
cgtccagttgtcatcaccgaggatggaattgattccatcgcgatccgtcagatggtcttc
ctgccactgacctacgatcaccaggttgtagatggcgcagatgctggtcgcttcctgacc
accatcaaggaccgccttgagaccgctaacttcgaaggcgatctgcagctctaa

DBGET integrated database retrieval system